![discount label](https://static.cymitquimica.com/public/img/discount.png)
Produktinformation
- H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-OH
- Corticotropin-Releasing Factor, Human and Rat
- Crf (Human, Rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemische Eigenschaften
Technische Anfrage zu: 3D-PP50518 CRF (human, rat)
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.