
Human beta-defensin-2 peptide
Ref. 3D-PP51063
100µg
555,00€

Produktinformation
Name:Human beta-defensin-2 peptide
Synonyme:
- H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH
Marke:Biosynth
Beschreibung:Human beta-defensin-2 (hBD-2), also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2, which belongs to the defensin family, is implicated in the innate immunity thanks to its antimicrobial activity. Thus, β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover, at the pulmonary level, defensins might be involved in the resorption of the infection in cases of cystic fibrosis.hBD-2 is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans, fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL). Besides its antimicrobial activity, hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells, immature dendritic cells, mast cells and neutrophils.hBD-2 has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.
Chemische Eigenschaften
Technische Anfrage zu: Human beta-defensin-2 peptide
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.