Mouse Beta-Defensin 3 peptide
Ref. 3D-PP51064
100µg | 533,00 € |
Produktinformation
- H-KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK-OH
mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family.
Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair.
mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL). Antimicrobial activity has also been demonstrated against C.Albicans.
The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.
Chemische Eigenschaften
Technische Anfrage zu: 3D-PP51064 Mouse Beta-Defensin 3 peptide
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.