
RANTES
Ref. 3D-PP51066
10µg
266,00€

Produktinformation
Name:RANTES
Synonyme:
- H-SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS-OH
Marke:Biosynth
Beschreibung:RANTES (or Regulated upon Activation, Normal T-cell Expressed and Secreted), also known as CCL5 (Chemokine (CC chemokine ligand 5), is a protein classified as a chemotactic cytokine or chemokine.Chemokines are small soluble proteins that act as molecular signals to induce cellular migration during inflammation.RANTES is a member of the CC chemokine family and is involved in immunoregulatory and inflammatory processes.RANTES is expressed in a lot of immune cells and acts as a potent chemoattractant for T-cells, basophils, eosinophils, monocytes and other cell types by playing a major role in recruiting leukocytes into inflammatory sites and to activate them. RANTES also induces proliferation and activation of certain natural killer cells.RANTES synthesis is induced by TNF-alpha and IL-1 alpha, interacts with CCR3, CCR1 and CCR5 and activates some G-protein coupled receptors.Many of the biological activities of RANTES (Ca2+ influx, chemotactic response, basophil activation, T-cell signaling) are observed between 40 and 8000 ng/mL.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.
Chemische Eigenschaften
Technische Anfrage zu: RANTES
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.