Thymosin β4 (human, bovine, horse, rat)

CAS: 77591-33-4

Ref. 3D-PT17109

Produktinformation

• Name: Thymosin β4 (human, bovine, horse, rat)
• Synonyme: H-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-OH
• Marke: Biosynth
• Beschreibung: Thymosin β4 (human, bovine, horse, rat) is a naturally occurring therapeutic peptide derived from various mammalian sources, including humans, cattle, horses, and rats. It is a member of the β-thymosin family and is ubiquitously expressed in many tissues. The primary mode of action of Thymosin β4 involves its ability to bind actin, thereby facilitating cell motility, angiogenesis, and wound repair. It plays a crucial role in cell migration and the formation of new blood vessels, which is essential for tissue regeneration.The uses and applications of Thymosin β4 are extensive, particularly in fields such as regenerative medicine and ophthalmology, where it is employed to promote healing and tissue repair. It has been investigated for its potential therapeutic effects in conditions such as myocardial infarction, corneal injuries, and chronic wounds due to its regenerative properties. As an endogenous peptide, Thymosin β4’s ability to enhance cellular repair mechanisms makes it a subject of ongoing research to fully elucidate its potential benefits and applications in clinical therapies.

Chemische Eigenschaften

• Molekulargewicht: 4,963.49 g/mol
• Formel: C₂₁₂H₃₅₀N₅₆O₇₈S
• Reinheit: Min. 95%