CAS 118997-30-1

péptido yy humano

Descripción:

El péptido YY (PYY) es un neuropeptido producido principalmente en el tracto gastrointestinal, particularmente en el íleon y el colon, en respuesta a la ingesta de alimentos. Juega un papel crucial en la regulación del apetito y el equilibrio energético al inhibir la motilidad gástrica y promover la saciedad. La forma humana de PYY, identificada por el número CAS 118997-30-1, consta de 36 aminoácidos y está estructuralmente relacionada con otros neuropeptidos como el neuropeptido Y (NPY) y el polipéptido pancreático (PP). El PYY se libera postprandialmente, lo que significa que sus niveles aumentan después de comer, y actúa sobre receptores específicos en el cerebro para reducir las señales de hambre. Además, se ha implicado al PYY en varios procesos fisiológicos, incluida la modulación de la secreción de insulina y la función gastrointestinal. Se están explorando sus posibles aplicaciones terapéuticas en el contexto de la obesidad y los trastornos metabólicos, ya que mejorar la señalización de PYY puede ayudar en la regulación del apetito y el manejo del peso. En general, el PYY es un jugador significativo en la compleja red de hormonas que gobiernan la homeostasis energética.

Fórmula: C₁₉₄H₂₉₅N₅₅O₅₇

Sinónimos:

• H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• Peptide YY (human)
• Peptide Yy, Human
• Peptide YY (human) Acetate
• PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
• PubChem ID: 126455957
• TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
• PEPTIDE YY, HUMAN USP/EP/BP
• Peptide YY (human)|Peptide YY, PYY, human
• PYY (HUMAN)
• PEPTIDE YY PYY HUMAN
• YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
• Peptide YY human, ≥97% (HPLC)
• M.W. 4309.75 C194H295N55O57
• H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• Human peptide YY

Peptide YY (human)

CAS: 118997-30-1

Peptide YY has been isolated from human colonic extracts. It is identical in sequence to porcine PYY except for two amino acid replacements.

Fórmula: C₁₉₄H₂₉₅N₅₅O₅₇

Pureza: > 95%

Forma y color: White Powder

Peso molecular: 4309.81

Ref: 01-4013882

Peptide YY (human)

CAS: 118997-30-1

Fórmula: C₁₉₄H₂₉₅N₅₅O₅₇

Pureza: 97%

Peso molecular: 4309.7524

Ref: IN-DA008RSH

Peptide YY (PYY), human

CAS: 118997-30-1

PYY: a 36-amino-acid hormone, amidated, part of neuroendocrine control, acts via Neuropeptide Y receptors.

Fórmula: C₁₉₄H₂₉₅N₅₅O₅₇

Pureza: 98%

Forma y color: Solid

Peso molecular: 4309.75

Ref: TM-TP1762

Peptide YY (human) trifluoroacetate salt

CAS: 118997-30-1

Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.

Fórmula: C₁₉₄H₂₉₅N₅₅O₅₇

Pureza: Min. 95%

Peso molecular: 4,309.75 g/mol

Ref: 3D-FP110394