CAS 12279-41-3

Seractida

Descripción:

Seractida, con el número CAS 12279-41-3, es un compuesto químico conocido principalmente por su aplicación en el campo de la farmacéutica y la bioquímica. Es un surfactante sintético que exhibe propiedades como emulsificación, humectación y dispersión, lo que lo hace útil en diversas formulaciones. Seractida se utiliza a menudo en la preparación de sistemas de liberación de fármacos, mejorando la solubilidad y biodisponibilidad de compuestos poco solubles. Su naturaleza anfifílica le permite interactuar con sustancias tanto hidrofílicas como hidrofóbicas, facilitando la estabilización de emulsiones y suspensiones. Además, Seractida puede poseer actividad biológica, contribuyendo a su papel en la mejora de la eficacia de los agentes terapéuticos. Las precauciones de seguridad y manejo son esenciales al trabajar con este compuesto, como con muchos surfactantes, debido a sus posibles propiedades irritantes. En general, Seractida sirve como una herramienta valiosa en formulaciones farmacéuticas e investigación, contribuyendo a los avances en tecnologías de liberación de fármacos.

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S₁

Sinónimos:

• L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
• Acth(1-39)
• CORTICOTROPIN (HUMAN)
• ACTH (1-39), HUMAN
• Seractide USP/EP/BP
• H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
• ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
• Seractide
• CORTICOTROPIN A
• REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
• ACTH (1-39) (huMan)
• Adrenocorticotropic hormone fragment 1-39, ≥97% (HPLC)
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
• ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
• Adrenocorticotropic Hormone (ACTH) (1-39)
• H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
• Seractide ACTH
• Adrenocorticotropic Hormone (ACTH) (1-39), human
• Seractide acetate
• PCorticotropin (Human) CAS 12279-41-3
• ACTH
• M.W. 4541.07 C207H308N56O58S
• CORTICOTROPHIN
• Corticotropin
• adrenocorticotropic hormone fragment 1-39
• SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
• ADRENOCORTICOTROPIC HORMONE HUMAN

ACTH (1-39) (human)

CAS: 12279-41-3

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: 99.2%

Forma y color: White

Peso molecular: 4541.13

Ref: 01-4030325

a1-39-Corticotropin (human)

CAS: 12279-41-3

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: 98%

Forma y color: Solid

Peso molecular: 4541.0658

Ref: IN-DA01CP9W

ACTH (1-39) human

CAS: 12279-41-3

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH (1-39), human) is an agonist of melanocortin receptor.

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: 99.6%

Forma y color: White Lyophilised Solid

Peso molecular: 4541.14

Ref: TM-T8231

ACTH(1-39) trifluoroacetate

CAS: 12279-41-3

ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: Min. 98 Area-%

Forma y color: Powder

Peso molecular: 4,541.07 g/mol

Ref: 3D-FA108368