CAS 130357-25-4

Exendina-3

Descripción:

Exendina-3 es un péptido que se deriva de la saliva del monstruo de Gila (Heloderma suspectum) y es conocido por su papel como agonista del receptor del péptido 1 similar al glucagón (GLP-1). Consiste en 39 aminoácidos y exhibe similitudes estructurales con el GLP-1 humano, que está involucrado en el metabolismo de la glucosa y la secreción de insulina. Exendina-3 ha ganado atención por sus posibles aplicaciones terapéuticas en el tratamiento de la diabetes tipo 2 y la obesidad debido a su capacidad para aumentar la secreción de insulina en respuesta a la glucosa, inhibir la liberación de glucagón y promover la saciedad. La sustancia se caracteriza por su estabilidad y acción prolongada en comparación con el GLP-1 nativo, lo que la convierte en un candidato valioso para el desarrollo farmacológico. Además, Exendina-3 ha sido estudiado por sus efectos neuroprotectores y posibles aplicaciones en enfermedades neurodegenerativas. Su número CAS, 130357-25-4, es un identificador único que facilita la identificación y el estudio de este compuesto químico específico en la literatura científica y en contextos regulatorios.

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Sinónimos:

• H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 >=97%
• HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• EXENDIN-3
• M.W. 4202.57 C184H282N50O61S
• HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN-3 USP/EP/BP
• HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Exendin-3

CAS: 130357-25-4

Exendin-3, a member of the glucagon superfamily, was originally isolated from the venom of the lizard, Heloderma horridum. At low concentrations, the 39-amino acid peptide interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, whereas at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release.

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Pureza: 98.6%

Peso molecular: 4202.63

Ref: 01-4015051

Exendin-3

CAS: 130357-25-4

Exendin-3, a peptide from Gila monster venom, stimulates pancreatic secretion and belongs to the glucagon family.

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Pureza: 98%

Forma y color: Solid

Peso molecular: 4202.57

Ref: TM-TP1768

Exendin-3

CAS: 130357-25-4

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Peso molecular: 4202.56

Ref: 7W-GK4553

Exendin-3

CAS: 130357-25-4

Please enquire for more information about Exendin-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Pureza: Min. 95%

Peso molecular: 4,202.57 g/mol

Ref: 3D-FE110340