CAS 133514-43-9
:fragmento de exendina 9-39
Descripción:
fragmento de exendina 9-39 es un péptido derivado de la molécula exendina-4, que es un análogo del péptido-1 similar al glucagón (GLP-1). Este fragmento específico es conocido por su papel como antagonista competitivo del receptor GLP-1, que es significativo en la regulación del metabolismo de la glucosa y la secreción de insulina. El péptido consta de 31 aminoácidos y se caracteriza por su capacidad para inhibir las acciones del GLP-1, lo que lo convierte en un tema de interés en la investigación sobre la diabetes y aplicaciones terapéuticas potenciales. Su estructura incluye una secuencia que le permite unirse al receptor GLP-1, pero a diferencia del GLP-1, no activa el receptor, bloqueando así sus efectos. El número CAS 133514-43-9 identifica de manera única este compuesto en bases de datos químicas, facilitando su estudio y aplicación en contextos farmacológicos. En general, fragmento de exendina 9-39 sirve como una herramienta valiosa para comprender la señalización del receptor GLP-1 y sus implicaciones en los trastornos metabólicos.
Fórmula:C149H234N40O47S
Sinónimos:- Exendin (9-39)
- Exendin(9-39)amide
- Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
- H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
- Exendin-3 (9-39) amide USP/EP/BP
- H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
- Exendin Fragment 9-39 >=95% (HPLC)
- 9-39-Exendin 3(Heloderma horridum) (9CI)
- EXENDIN-3 (9-39) AMIDE
- H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
- 9-39-Exendin 3(Heloderma horridum)
- DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p...
- Exendin 4 (9-39) amide
- ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- M.W. 3369.79 C149H234N40O47S
- Exendin FragMent 9-39Exendin
- ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
- EXENDIN [9-39] PEPTIDE
- EXENDIN FRAGMENT 9-39
- EXENDIN FRAGMENT 9-39;EXENDIN (9-39)
- Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC)
- Exendin (9-39) Acetate
- Ver más sinónimos
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Encontrado 7 productos.
Exendin (9-39)
CAS:For cellular and molecular biology applicationsFórmula:C149H234N40O47SPeso molecular:3369.75Exendin (9-39)
CAS:Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.Fórmula:C149H234N40O47SPureza:97.4%Forma y color:White PowderPeso molecular:3369.8Exendin Fragment 9-39
CAS:Fórmula:C149H234N40O47SPureza:≥ 95.0%Forma y color:White powderPeso molecular:3369.75Avexitide
CAS:Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.Fórmula:C149H234N40O47SPureza:98% - 99.65%Forma y color:SolidPeso molecular:3369.76Exendin (9-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C149H234N40O47SPeso molecular:3,369.79 g/molExendin (9-39) acetate
CAS:Exendin (9-39) acetate is a peptide hormone that is derived from the salivary gland of the Gila monster. It binds to receptors in the pancreas and inhibits insulin release. Exendin (9-39) acetate has been shown to increase glomerular filtration rate, natriuresis, and plasma glucose levels in animals. This peptide also increases soluble guanylate cyclase activity, which leads to an increase in cellular cGMP levels and vasodilation. Exendin (9-39) acetate has been shown to inhibit the production of cyclic guanosine monophosphate (cGMP) by inhibiting adenylyl cyclase activity. It also binds to receptors on pancreatic beta cells and inhibits insulin release, as well as binding to receptors on vascular smooth muscle cells and causing vasodilation.Fórmula:C149H234N40O47SPureza:Min. 95%Peso molecular:3,369.76 g/mol






