CAS 197922-42-2
:Teduglutida
Descripción:
Teduglutida es un análogo sintético del péptido similar al glucagón humano-2 (GLP-2), una hormona involucrada en la regulación del crecimiento y la función intestinal. Se utiliza principalmente en el tratamiento del síndrome del intestino corto, una condición que puede surgir después de la extirpación quirúrgica de una parte significativa del intestino. Teduglutida promueve la absorción intestinal de nutrientes y líquidos, mejorando así la calidad de vida de los pacientes con esta condición. La sustancia se administra mediante inyección subcutánea y tiene una vida media relativamente larga debido a su resistencia a la degradación enzimática. Su mecanismo de acción implica la unión al receptor de GLP-2, lo que lleva a un crecimiento mejorado de la mucosa intestinal, un aumento en la altura de las vellosidades y una mejor absorción de nutrientes. Los efectos secundarios comunes pueden incluir síntomas gastrointestinales, como náuseas y dolor abdominal, así como riesgos potenciales de neoplasia debido a sus efectos promotores del crecimiento. En general, Teduglutida representa un avance significativo en el manejo del síndrome del intestino corto, ofreciendo a los pacientes un mejor estado nutricional y una menor dependencia del soporte parenteral.
Fórmula:C164H252N44O55S
Sinónimos:- Alx 0600
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Encontrado 7 productos.
Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)
CAS:Producto controladoApplications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)Fórmula:C164H244D8N44O55S•C2HF3O2•x(H2O)Forma y color:NeatPeso molecular:3760.081140218Teduglutide
CAS:Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).Fórmula:C164H252N44O55SPureza:98.08%Forma y color:SolidPeso molecular:3752.08Teduglutide (GLP2 2G)
CAS:Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.Fórmula:C164H252N44O55SForma y color:PowderPeso molecular:3,749.8 g/molTeduglutide
CAS:Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITDFórmula:C164H252N44O55SPureza:Min. 95%Peso molecular:3,752.16 g/molTeduglutide trifluoroacetate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C164H252N44O55SPeso molecular:3,752.08 g/molRef: 3D-PP50564
Producto descatalogado





