CAS 90880-35-6

neuropéptido Y humano

Descripción:

El neuropéptido Y (NPY) es un péptido de 36 aminoácidos que desempeña un papel crucial en varios procesos fisiológicos, incluida la regulación del apetito, los ritmos circadianos y la respuesta al estrés. Se produce principalmente en el sistema nervioso central y está involucrado en la neurotransmisión. La forma humana del neuropéptido Y, identificada por el número CAS 90880-35-6, exhibe un alto grado de conservación entre especies, lo que indica su importancia biológica fundamental. El NPY funciona al unirse a receptores específicos, principalmente los receptores Y1 y Y2, que son receptores acoplados a proteínas G. Esta unión puede influir en una variedad de respuestas celulares, incluida la modulación de la liberación de neurotransmisores y la regulación del equilibrio energético. Además, el NPY está implicado en diversas condiciones patológicas, como la obesidad, la ansiedad y la depresión, lo que lo convierte en un objetivo para la investigación terapéutica. Su estabilidad y bioactividad están influenciadas por factores como las modificaciones post-traduccionales y la presencia de subtipos de receptores específicos, lo que destaca su complejidad como molécula de señalización en el sistema nervioso.

Fórmula: C₁₈₉H₂₈₄N₅₅O₅₇RS

Sinónimos:

• Neuropeptide Y (human), 36-L-tyrosine-
• NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
• Neuropeptide Y, Human
• NEUROPEPTIDE Y (HUMAN, RAT) USP/EP/BP
• hnpy
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt
• REF DUPL: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• Neuropeptide Y (29-64), amide, human
• Neuropeptide Y (huMan, rat)
• hNPY, NPY
• Neuropeptide Y (Alligator mississippiensis)
• Neuropeptide Y (human, rat) Acetate
• NEUROPEPTIDE Y (HUMAN, RAT)
• Human neuropeptide Y (29-64)
• YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• M.W. 4271.68 C189H285N55O57S
• Neuropeptide Y (rat)
• NPY (HUMAN, RAT)
• H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
• NPY FREE ACID (HUMAN, RAT)
• Neuropeptide Y (Gopherus agassizii)
• H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
• NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
• Neuropeptide Y (human pheochromocytoma)
• NPY (huMan, rat)
• TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR
• Neuropeptide Y(1-36)

Neuropeptide Y, Human

CAS: 90880-35-6

For cellular and molecular biology applications

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Peso molecular: 4271.74

Ref: 02-J66797

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Bachem ID: 4012616.

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Pureza: 95.2%

Forma y color: White

Peso molecular: 4271.74

Ref: 01-4012616

Neuropeptide Y (human, rat)

CAS: 90880-35-6

Fórmula: C₆₅H₁₄₂N₂₆O₃

Pureza: 98%

Peso molecular: 1335.9954

Ref: IN-DA00GRZM

Neuropeptide Y (human)

CAS: 90880-35-6

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Pureza: 98%

Forma y color: Solid

Peso molecular: 4271.68

Ref: TM-TP1140

Neuropeptide Y

CAS: 90880-35-6

Neuropeptide Y

Ref: 54-BIBA1035

NPY (Human, Rat)

CAS: 90880-35-6

NPY is a potent inhibitor of the ion channel TRPM2. This protein has been shown to be involved in a variety of physiological functions, including regulation of body weight and food intake, sleep-wake cycles, and pain perception. It is also an important regulator of neuronal excitability. NPY (Human) can be used as a research tool for studying protein interactions or investigating the function of ion channels in cellular systems. NPY (Rat) can be used as an antibody for immunohistochemistry or Western blotting experiments.

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Pureza: Min. 95%

Peso molecular: 4,271.7 g/mol

Ref: 3D-PNP-4158-S

Neuropeptide Y, human

CAS: 90880-35-6

Neuropeptide Y is a potent neuropeptide that regulates many biological processes in vertebrates. It has been shown to regulate various processes, including feeding, anxiety, reproduction, and pain. Neuropeptide Y is synthesized as an amide of the amino acid L-tyrosine. The synthetic peptide can be either enantiomer or a mixture of both enantiomers. The presence of neuropeptides Y in the extracellular fluid is potently regulated by the neuropeptide Y receptor subtype 2 (Y2R). Neuropeptide Y has been shown to inhibit egg development in mosquitoes when injected into their ovaries at high doses. This effect was dose-dependent and was mediated by receptors on the surface of cho-k1 cells (a rat kidney cell line). The homologues of neuropeptide Y are called peptides PYY and PYY3-36.

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Pureza: Min. 95%

Peso molecular: 4,271.69 g/mol

Ref: 3D-FN73521

NPY (Human, Rat)

CAS: 90880-35-6

NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Pureza: Min. 95%

Peso molecular: 4,271.7 g/mol

Ref: 3D-PNP-4158-V

Neuropeptide Y (human, rat) trifluoroacetate salt

CAS: 90880-35-6

Please enquire for more information about Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Pureza: Min. 95%

Peso molecular: 4,271.69 g/mol

Ref: 3D-FN109816