CAS 99575-89-0

neuropéptido Y humano

Descripción:

El neuropéptido Y (NPY) es un péptido de 36 aminoácidos que desempeña un papel crucial en varios procesos fisiológicos, incluyendo la regulación del apetito, los ritmos circadianos y la respuesta al estrés. Se produce principalmente en el sistema nervioso central y está involucrado en la neurotransmisión. El número CAS 99575-89-0 se refiere específicamente a la forma humana del neuropéptido Y. Este péptido se caracteriza por su capacidad para unirse a receptores específicos, particularmente los receptores Y1, Y2 y Y5, que median sus diversos efectos biológicos. Se conoce que el NPY tiene propiedades orexigénicas potentes (estimulantes del apetito), lo que lo convierte en un factor significativo en la homeostasis energética. Además, se ha implicado en la modulación de la ansiedad y las respuestas al estrés, así como en la regulación cardiovascular. La estructura del NPY incluye una región C-terminal conservada que es crítica para la unión y actividad del receptor. En general, el neuropéptido Y es un componente vital de la señalización neuroendocrina, influyendo en una amplia gama de funciones fisiológicas en los humanos.

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S

Sinónimos:

• Neuropeptide Y (human), 36-L-tyrosine-
• NeuropeptideY (pig), 17-L-methionine-36-L-tyrosine-
• Neuropeptide Y, Human
• Neuropeptide Y (free acid) (huMan, rat)
• NPY (HUMAN, RAT)
• [D-Trp34]-NPY, human-[D-Trp34]
• NPY (free acid) (huMan, rat)
• H-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-OH
• NPY FREE ACID (HUMAN, RAT)
• NEUROPEPTIDE Y (HUMAN, RAT)
• YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
• NEUROPEPTIDE Y FREE ACID (HUMAN, RAT)
• TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2
• Neuropeptide Y (pig),17-L-methionine-36-L-tyrosine-
• TYP-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR

Neuropeptide Y (free acid) (human, rat)

CAS: 99575-89-0

Desamidation of neuropeptide Y suppresses almost all of NPY effects.

Fórmula: C₁₈₉H₂₈₄N₅₄O₅₈S

Pureza: > 96%

Forma y color: White Powder

Peso molecular: 4272.73

Ref: 01-4031097

Neuropeptide Y (human) free acid

CAS: 99575-89-0

Neuropeptide Y (human) free acid is the deamidated form of Neuropeptide Y (human, rat, mouse). The amidation of the C-terminal tyrosine in Neuropeptide Y is essential for its function, while the non-amidated form cannot initiate G-protein signaling.

Fórmula: C₁₈₉H₂₈₄N₅₄O₅₈S

Peso molecular: 4270.06542

Ref: TM-TP3545

Neuropeptide Y (free acid) (human)

CAS: 99575-89-0

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Fórmula: C₁₈₉H₂₈₄N₅₄O₅₈S₁

Peso molecular: 4,272.8 g/mol

Ref: 3D-PP50004

Neuropeptide Y, human, rat

CAS: 99575-89-0

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Fórmula: C₁₈₉H₂₈₅N₅₅O₅₇S₁

Peso molecular: 4,271.74 g/mol

Ref: 3D-PP50242

Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt

CAS: 99575-89-0

Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fórmula: C₁₈₉H₂₈₄N₅₄O₅₈S

Pureza: Min. 95%

Peso molecular: 4,272.67 g/mol

Ref: 3D-FN108972