
Receptor de glucagón
Los receptores de glucagón son GPCR que median los efectos del glucagón, una hormona involucrada en la regulación de la homeostasis de la glucosa al promover la descomposición del glucógeno y la liberación de glucosa desde el hígado. Estos receptores son cruciales en la gestión de los niveles de azúcar en sangre y son de particular interés en el estudio de la diabetes y los trastornos metabólicos. Los antagonistas de los receptores de glucagón se están explorando como posibles tratamientos para la hiperglucemia en la diabetes tipo 2. En CymitQuimica, ofrecemos una variedad de moduladores de receptores de glucagón de alta calidad para apoyar su investigación en endocrinología, diabetes y regulación metabólica.
Se han encontrado 164 productos de "Receptor de glucagón"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Fórmula:C148H221N41O47SPureza:98%Forma y color:SolidPeso molecular:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Fórmula:C32H33N5O4SeForma y color:SolidPeso molecular:630.6(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Fórmula:C20H26ClF3N4O2Forma y color:SolidPeso molecular:446.89GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Fórmula:C46H47FN8O7SForma y color:SolidPeso molecular:874.98Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Forma y color:LiquidAnti-GLP-1R Antibody
<p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>Pureza:98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Forma y color:Odour LiquidSPN009
<p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>Fórmula:C191H299N45O59Peso molecular:4167.17798Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Fórmula:C188H276N51F3O61Pureza:98%Forma y color:SolidPeso molecular:4283.5GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Fórmula:C31H30Cl2F2N4O5Peso molecular:646.15613GLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Fórmula:C50H58FN10O6PForma y color:SolidPeso molecular:945.03GLP-1R agonist 4
CAS:<p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>Fórmula:C32H30ClF2N3O5Forma y color:SolidPeso molecular:610.05SAR441255
<p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>Forma y color:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Forma y color:SolidPeso molecular:3692.15Dapiglutide
CAS:<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Forma y color:SolidGRPP (human)
CAS:<p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>Fórmula:C136H215N41O58SForma y color:SolidPeso molecular:3384.47Glucagon (1-29), bovine, human, porcine
CAS:<p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>Fórmula:C153H225N43O49SPureza:99.56% - 99.56%Forma y color:SolidPeso molecular:3482.75GLP-1 receptor agonist 7
CAS:<p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>Fórmula:C31H30ClFN4O5Forma y color:SolidPeso molecular:593.05GLP-1 receptor agonist 2
CAS:<p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Fórmula:C30H31ClFN5O4Forma y color:SolidPeso molecular:580.05V-0219
CAS:<p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>Fórmula:C20H25F3N4O2Pureza:99.91%Forma y color:SoildPeso molecular:410.43GLP-1R modulator C16
CAS:<p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>Fórmula:C21H26ClFN2O3Pureza:99.6% - >99.99%Forma y color:SolidPeso molecular:408.89

