
Haluros orgánicos
En esta categoría, encontrará moléculas orgánicas que contienen uno o más átomos de halógeno en su estructura. Estos haluros orgánicos incluyen compuestos bromados, yodados, clorados y haluros cíclicos. Los haluros orgánicos se utilizan ampliamente en la síntesis orgánica, productos farmacéuticos, agroquímicos y ciencia de materiales debido a su reactividad y capacidad para someterse a diversas transformaciones químicas. En CymitQuimica, ofrecemos una selección integral de haluros orgánicos de alta calidad para apoyar sus aplicaciones de investigación e industriales, garantizando un rendimiento confiable y efectivo en sus proyectos sintéticos y analíticos.
Subcategorías de "Haluros orgánicos"
Se han encontrado 20437 productos de "Haluros orgánicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
1-Chloro-3-iodobenzene
CAS:<p>1-Chloro-3-iodobenzene is a chemical compound that is used in the synthesis of ceramics. It is a colorless solid with a melting point of 337℃ and has a molecular weight of 160.161 g/mol. 1-Chloro-3-iodobenzene can be synthesized by reacting zinc powder with ethylmagnesium chloride in the presence of an aluminium catalyst. This reaction produces 1-chloro-3-iodobenzene, which can then be reacted with carbonyl chloride to produce aminocarbonylation products. The chemical compound was first synthesized by Grignard reagents, which are organometallic compounds containing a carbon atom bonded to a magnesium ion. Kinetic studies have shown that 1-chloro-3-iodobenzene reacts with hydroxide ions to form fluorescent products, although it is not reactive towards water or ammonia.</p>Fórmula:C6H4ClIPureza:Min. 95%Peso molecular:238.45 g/molBoc-Leu-Lys-Arg-AMC hydrochloride salt
CAS:<p>Boc-Leu-Lys-Arg-AMC is a synthetic substrate that has been used in a number of clinical studies to identify the serine proteases that are involved in autoimmune diseases. It is a synthetic peptide composed of the amino acid sequence found in soybean trypsin. The peptide was shown to have high salt tolerance and was able to be hydrolyzed by polyclonal antibodies with specificity for amyloid protein, suggesting it may be useful as a biochemical marker for Alzheimer's disease. Boc-Leu-Lys-Arg-AMC has also been shown to be an efficient substrate for collagenase, which is an enzyme that breaks down collagen and causes tissue damage. This property makes this compound useful as a proteolytic agent for the removal of unwanted scar tissue or other lesions from diseased organs. Boc-Leu-Lys-Arg-AMC also has an optimum pH level of 7.5 and is active against influenza</p>Fórmula:C33H52N8O7Pureza:Min. 95%Peso molecular:672.82 g/molEthyl 2,4-dichloropyrimidine-5-carboxylate
CAS:<p>Please enquire for more information about Ethyl 2,4-dichloropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C7H6Cl2N2O2Pureza:Min. 95%Peso molecular:221.04 g/mol4-Chloro-2-iodo-phenol
CAS:<p>Please enquire for more information about 4-Chloro-2-iodo-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C6H4ClIOPureza:Min. 95%Peso molecular:254.45 g/mol(Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct
CAS:<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C66H86N18O12Pureza:Min. 95%Peso molecular:1,323.5 g/molH-Cys(Acm)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Cys(Acm)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Neuropeptide AF (human) trifluoroacetate salt
CAS:<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>Fórmula:C90H132N26O25Pureza:Min. 95%Peso molecular:1,978.17 g/molThrombin Receptor Antagonist trifluoroacetate salt
CAS:<p>Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C58H91N17O20S2Pureza:Min. 95%Peso molecular:1,410.58 g/mol(Deamino-Cys1,b-cyclohexyl-Ala4,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>Fórmula:C50H71N13O11S2Pureza:Min. 95%Peso molecular:1,094.31 g/molAnthranilyl-HIV Protease Substrate V trifluoroacetate salt
CAS:<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C50H76N14O13Pureza:Min. 95%Peso molecular:1,081.23 g/molAdropin (34-76) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C190H293N55O68S2Pureza:Min. 95%Peso molecular:4,499.82 g/mol5,6-Dichloronicotinic acid
CAS:<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>Fórmula:C6H3Cl2NO2Forma y color:PowderPeso molecular:192 g/mol6,8-Dichlorochromone-2-carboxylic acid
CAS:<p>6,8-Dichlorochromone-2-carboxylic acid is a fine chemical that is used as a building block in the synthesis of complex compounds. It is also a versatile building block that can be used in many reactions, such as nucleophilic substitution, electrophilic addition, and condensation reactions. This compound has CAS number 16722-38-6 and is a reagent for research purposes.</p>Fórmula:C10H4Cl2O4Pureza:Min. 95%Forma y color:PowderPeso molecular:259.04 g/mol2-Chloro-5-pyridylcarbinol
CAS:<p>2-Chloro-5-pyridylcarbinol is an alkene that features a five-membered ring. It is a conformationally rigid molecule, which means it has no rotational or vibrational barriers. The molecule can be classified as a tricyclic heterocycle because the carbon atoms are arranged in three rings. The analogues of this compound feature six-membered carbocycles and intramolecular cycloadditions. 2-Chloro-5-pyridylcarbinol also constitutes one of the azomethine adducts of nicotine, which is a type of tricyclic heterocycle.</p>Fórmula:C6H6ClNOPureza:Min. 95%Peso molecular:143.57 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C206H326N56O64SPureza:Min. 95%Peso molecular:4,643.2 g/mol2-Cyclohexylethanamine hydrochloride
CAS:<p>Please enquire for more information about 2-Cyclohexylethanamine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H18ClNPureza:Min. 95%Forma y color:PowderPeso molecular:163.69 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:<p>Trifluoroacetate salt</p>Fórmula:C134H207N41O36SPureza:Min. 95%Peso molecular:3,000.4 g/mol4-Bromo-2-pyrrolecarboxaldehyde
CAS:<p>4-Bromo-2-pyrrolecarboxaldehyde is a synthetic chemical that is used as an antifungal agent. It inhibits the growth of filamentous fungi by binding to their pyrrole rings and inhibiting the synthesis of proteins. 4-Bromo-2-pyrrolecarboxaldehyde has shown in vitro antifungal activity against isolates of Candida albicans, Aspergillus niger, and Fusarium oxysporum. This compound also has substitutions at positions 1 and 2 of the pyrrole ring, which are thought to be responsible for its inhibitory properties. 4-Bromo-2-pyrrolecarboxaldehyde is soluble in organic solvents such as acetone and chloroform.</p>Fórmula:C5H4BrNOPureza:Min. 95%Forma y color:PowderPeso molecular:174 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C187H320N56O50Pureza:Min. 95%Peso molecular:4,152.89 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H79N9O12Pureza:Min. 95%Peso molecular:1,070.28 g/molAmyloid Dan Protein (1-34) (reduced) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C185H270N48O51S2Pureza:Min. 95%Peso molecular:4,046.55 g/mol(Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H84N16O12Pureza:Min. 95%Peso molecular:1,209.4 g/mol2-Amino-3,5-dibromobenzonitrile
CAS:<p>2-Amino-3,5-dibromobenzonitrile is an electrophile that is used to synthesize various boronic acid derivatives. It also inhibits butyrylcholinesterase and 2-aminobenzonitrile, enhancing the activity of organophosphorus cholinesterase inhibitors. 2-Amino-3,5-dibromobenzonitrile has been shown to react with nucleophiles at the alpha position to form a stable intermediate. This reaction has been shown to be reversible in aqueous solution. The compound has been evaluated as a potential chemotherapeutic agent against cancer cells in vitro.</p>Fórmula:C7H4Br2N2Pureza:Min. 95%Peso molecular:275.93 g/molMca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C66H81N15O19Pureza:Min. 95%Peso molecular:1,388.44 g/molH-Gln(Trt)-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%3,3'-Dichlorodiphenylacetylene
CAS:<p>3,3'-Dichlorodiphenylacetylene is a versatile building block that is used in the synthesis of complex compounds. It has been used as a reagent and as a speciality chemical for research purposes. This chemical can be used as a useful building block for the synthesis of other compounds, or it can be reacted with other compounds to form new compounds. 3,3'-Dichlorodiphenylacetylene is also an intermediate in organic syntheses and has been shown to react with many different types of molecules.</p>Fórmula:C14H8Cl2Pureza:Min. 95%Forma y color:PowderPeso molecular:247.12 g/molInfluenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt
CAS:<p>Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.</p>Fórmula:C63H90N14O16Pureza:Min. 95%Peso molecular:1,299.47 g/mol(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C33H43N5O8Pureza:Min. 95%Peso molecular:637.72 g/molBoc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt
CAS:<p>Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H32N4O4Pureza:Min. 95%Peso molecular:344.45 g/mol3-Bromopyridin-4-ol
CAS:<p>3-Bromopyridin-4-ol is a pyrrole that can be used as a cancer therapy. It inhibits the growth of cancer cells by binding to the mkn-45 on the surface of the cell, which prevents it from binding to other proteins and initiating cell proliferation. 3-Bromopyridin-4-ol also inhibits 2-amino-4-hydroxypyridine aminations, which are reactions that produce compounds that promote cancer. This compound class has inhibitory activity against the growth of cancer cells in vitro and in vivo. 3-Bromopyridin-4-ol is an oxindole and amide with a hydroxy group on its side chain. It can be synthesized from 3-bromo-5 hydroxypyridine by reacting it with ammonia or methylamine. The synthesis of this compound can be achieved by reacting 2 chloroacetaldehyde with nitroethane in presence</p>Fórmula:C5H4BrNOPureza:Min. 95%Forma y color:PowderPeso molecular:174 g/molCinchonine Hydrochloride Hydrate
CAS:<p>Cinchonine hydrochloride hydrate is a compound that belongs to the class of amines. It is used as an anti-malarial drug, an anti-arrhythmic agent, and a vasodilator. Cinchonine hydrochloride hydrate has been shown to be heat resistant and can be used in pharmaceutical preparations such as gel permeation chromatography. This compound also has a catalytic effect on reactions with glycerin and piperidone, which are used in the production of various dyes. Cinchonine hydrochloride hydrate can also be used as a solid catalyst for viscosity measurements in wastewater treatment plants.</p>Fórmula:C19H22N2O·HCl·xH2OPureza:Min. 95%Peso molecular:330.85 g/mol2-Amino-4-fluorobenzaldehyde
CAS:<p>2-Amino-4-fluorobenzaldehyde is a plant growth regulator that has been shown to be effective at increasing the yield of flowers and fruit crops. It is used as an intermediate in the synthesis of agrochemicals, such as 2-aminobenzaldehyde and anthranilic acid. The biosynthesis of 2-amino-4-fluorobenzaldehyde starts from methanol and intermediates such as anthranilic acid, aminoaldehydes, or alcohols. It can also be produced by oxidative coupling of 2-aminobenzaldehyde with phenylacetone in the presence of sodium hydroxide. 2-Amino-4-fluorobenzaldehyde has been shown to be more efficient than other plant growth regulators such as robinia or aminocyclopentane carboxylic acid (ACC).</p>Fórmula:C7H6FNOPureza:Min. 95%Forma y color:SolidPeso molecular:139.13 g/molCaloxin 2A1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H91N19O22Pureza:Min. 95%Peso molecular:1,478.52 g/molAcetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C42H63N9O8Pureza:Min. 95%Peso molecular:822.01 g/molCorticostatin I (rabbit) trifluoroacetate salt
CAS:<p>Please enquire for more information about Corticostatin I (rabbit) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C163H259N63O44S6Pureza:Min. 95%Peso molecular:3,997.59 g/mol4-Bromobenzo[b]thiophene
CAS:<p>Intermediate in the synthesis of brexpiprazole</p>Fórmula:C8H5BrSPureza:Min. 95%Peso molecular:213.1 g/molCART (61-102) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H310N58O56S7Pureza:Min. 95%Peso molecular:4,515.3 g/mol3-Bromo-2-methyl-5-nitropyridine
CAS:<p>Please enquire for more information about 3-Bromo-2-methyl-5-nitropyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C6H5BrN2O2Pureza:Min. 95%Peso molecular:217.02 g/mol2-Bromoethylamine hydrobromide
CAS:<p>2-Bromoethylamine HBr is a nonsteroidal anti-inflammatory drug that is used to treat inflammation and pain. It is a prodrug that is hydrolyzed in vivo to its active form, 2-bromoethylamine. The bound form of this drug has been shown to inhibit the development of cell nuclei in the nucleus of cells. This drug also inhibits the production of nitric oxide, which leads to cell death by necrosis. 2-Bromoethylamine HBr has been shown to have an inhibitory effect on the activity of glycol ethers, which are used as solvents for resins in coatings and adhesives. It also has the ability to form body tissue (e.g., papillary) and can be used as an experimental model for studying necrosis.</p>Fórmula:C2H6BrN•HBrPureza:Min. 95%Forma y color:White PowderPeso molecular:204.89 g/molH-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%(D-Phe2·6,Pro3)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Phe2·6,Pro3)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H80N14O13Pureza:Min. 95%Peso molecular:1,193.35 g/molDL-Methionine methylsulfonium chloride
CAS:<p>DL-Methionine methylsulfonium chloride is a fine chemical that has many uses. It can be used as a versatile building block for research and synthesis of complex compounds, or as an intermediate for the production of speciality chemicals. DL-Methionine methylsulfonium chloride is also useful as a reaction component in organic synthesis and as a reagent in analytical chemistry. It is often used to introduce methionine residues into proteins, which are then used for structural studies and protein engineering. The quality of this compound is high and it has CAS number 3493-12-7.</p>Fórmula:C6H14ClNO2SForma y color:White PowderPeso molecular:199.7 g/mol2-Chloro-3,5-dinitrobenzotrifluoride
CAS:<p>2-Chloro-3,5-dinitrobenzotrifluoride is a chemical compound that is used as an intermediate in the synthesis of dyes and pharmaceuticals. It reacts with nitrous acid to form 2-chloro-3,5-dinitrobenzoic acid. The hydrogen bond between the hydroxyl group and the chlorine atom in this compound is weak, which leads to a constant value for its spectrometer. This chemical compound has photophysical properties that are dependent on the concentration of solutes. When it is mixed with other solutes such as potassium ion or sulfoxide, it can produce isomers. This chemical compound can be refluxed in a neutral pH environment to form anilines and acetonitrile, two compounds that are important for organic synthesis.</p>Fórmula:C7H2ClF3N2O4Pureza:Min. 95%Forma y color:Light (Or Pale) Yellow To Yellow SolidPeso molecular:270.55 g/mol3-Chloropyridazine-4-carbonitrile
CAS:<p>3-Chloropyridazine-4-carbonitrile is an acridone that has been shown to be an effective antibacterial agent. It was synthesized by the intramolecular Diels-Alder reaction of pyridine and 1,3-butadiene, followed by a sequence of reactions involving thioxanthones. 3-Chloropyridazine-4-carbonitrile binds to the bacterial enzyme 50S ribosomal subunit by competitive inhibition and prevents the formation of an antibiotic inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. 3-Chloropyridazine-4-carbonitrile also has shown activity against methicillin resistant Staphylococcus aureus strains.</p>Fórmula:C5H2ClN3Pureza:Min. 95%Peso molecular:139.54 g/molCys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H93N15O14S2Pureza:Min. 95%Peso molecular:1,204.51 g/molH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%(Gly14)-Humanin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly14)-Humanin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C118H202N34O31S2Pureza:Min. 95%Peso molecular:2,657.21 g/mol2-Cyano-3,4,5,6-tetrachloropyridine
CAS:<p>2-Cyano-3,4,5,6-tetrachloropyridine is a genotoxic compound that is used for the preparation of picolinic acid. It has been shown to induce DNA damage and cytotoxicity in vitro. The reaction products of this compound have also been found to be genotoxic in vitro and in vivo. This chemical has been shown to inhibit the growth of cells in culture as well as cause cell death by releasing hydrogen chloride gas. 2-Cyano-3,4,5,6-tetrachloropyridine is a potent mutagen and carcinogen that can be activated by fluorine or chlorine compounds. This chemical can also form chlorinated derivatives with chlorine. 2-Cyano-3,4,5,6-tetrachloropyridine reacts with phosphorus pentachloride to produce hydrogen chloride gas and other reaction products such as chloride (Cl) or sublimed (P</p>Fórmula:C6Cl4N2Pureza:Min. 95%Peso molecular:241.89 g/molNocistatin (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nocistatin (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C82H135N21O32Pureza:Min. 95%Peso molecular:1,927.07 g/mol2-Hydroxy-4-fluorobenzaldehyde
CAS:<p>2-Hydroxy-4-fluorobenzaldehyde is a chemical used as a diagnosis agent to detect radiation exposure. It reacts with magnesium and water molecules to form an amination reaction that produces hydrogen fluoride gas. 2-Hydoxy-4-fluorobenzaldehyde has been shown to have the ability to penetrate into mitochondria, which may be related to its use in the treatment of hepatitis. The chemical structure of this compound is similar to salicylaldehyde, which is used as a reagent for formylation reactions and optical properties. It has also been shown that 2-hydroxy-4-fluorobenzaldehyde can act as a fluorescence probe for the detection of hydrophobic regions on proteins.</p>Fórmula:C7H5FO2Pureza:Min. 95%Forma y color:PowderPeso molecular:140.11 g/mol5-Bromo-2-hydroxybenzaldehyde
CAS:<p>5-Bromo-2-hydroxybenzaldehyde (5BHB) is an organic compound that has been shown to have a coordination geometry of group p2. This compound binds to DNA and RNA, inhibiting the transcription process. 5BHB also has the ability to form a copper complex with malonic acid. This redox potential is reduced by one electron when copper is added in order to form the copper complex, which allows for the reactivity of 5BHB to be increased. 5BHB binds to nucleic acids through hydrogen bonding interactions with nitrogen atoms and lone pairs on oxygen atoms. The reaction mechanism for 5BHB involves intramolecular hydrogen transfer from one molecule of 5BHB to another, forming an intermediate that then reacts with nucleic acid.</p>Fórmula:C7H5BrO2Pureza:Min. 95%Forma y color:White PowderPeso molecular:201.02 g/molBiotinyl-Substance P trifluoroacetate salt
CAS:<p>Biotinyl-Substance P trifluoroacetate salt Biotinyl-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2 trifluoroacetate salt is a biotin conjugated Substance P analog. It is designed to bind to the amino acid sequences in the brain that are responsible for controlling and regulating pain. The drug's amino acid sequence was designed by accessing databases of amino acid sequences from all known organisms. The drug is administered as a sequence of cassettes, each containing an acid molecule that can be transferred to cells through nucleotide transfer.</p>Fórmula:C73H112N20O15S2Pureza:Min. 95%Peso molecular:1,573.93 g/mol2-Bromo-6-chloroaniline
CAS:<p>2-Bromo-6-chloroaniline is a brominated derivative of aniline that is used as a detector. It has been shown to be useful in the determination of electron concentration, as well as being sensitive to changes in environment temperature. 2-Bromo-6-chloroaniline is nonpolar and has been used for the separation of isomers in gas chromatography.</p>Fórmula:C6H5BrClNPureza:Min. 95%Peso molecular:206.47 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C50H77N9O12SPureza:Min. 95%Peso molecular:1,028.27 g/mol(D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H82N18O13Pureza:Min. 95%Peso molecular:1,311.45 g/molβ-Bag Cell Peptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Aplysia californica is a species of sea slug that produces a peptide, beta-Bag Cell Peptide (BACP), which has been shown to have depolarizing effects on neurons. BACP can be synthesized from the amino acid sequence of the Aplysia californica cell membrane protein, and this synthetic peptide has been shown to have maximal depolarizing effects at high concentrations. The depolarizing effect of BACP can be seen in populations of neurons as well as individual neurons. This peptide also desensitizes autoreceptors for acetylcholine and serotonin, which may play a role in its electrophysiological effects.</p>Fórmula:C33H53N13O6Pureza:Min. 95%Peso molecular:727.86 g/mol2-Aminoacetophenone hydrochloride
CAS:Producto controlado<p>2-Aminoacetophenone hydrochloride is a chemical compound that is used in analytical chemistry as a reagent for the determination of protein and amino acid concentrations. This reagent can be prepared in various forms, depending on the type of analysis being performed. 2-Aminoacetophenone hydrochloride is used to determine the concentration of free amino acids in a sample by binding to it. It can also be used for determining the concentration of bound amino acids by reacting with them with hydrochloric acid. 2-Aminoacetophenone hydrochloride is an excellent substrate for matrix effect, which may cause errors in measurement due to interference from other substances present in the sample. The use of light exposure reduces this problem by removing interfering substances from the sample.</p>Fórmula:C8H9NO·HClPureza:Min. 95%Forma y color:PowderPeso molecular:171.62 g/molMonocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Monocyte Chemotactic Protein-1 (65-76) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H98N18O22Pureza:Min. 95%Peso molecular:1,411.52 g/molH-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%BNP-26 (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about BNP-26 (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C120H198N42O36S2Pureza:Min. 95%Peso molecular:2,869.25 g/mol(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone
CAS:<p>(3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone is an organic compound that belongs to the class of carbonyl reductase. It is used as a catalyst for the transformation of secondary alcohols to ketones or aldehydes, including isopropyl alcohol. The reaction proceeds via an intermediate carboxylic acid. The enzyme has been found in various microorganisms, and can be purified from Bacillus megaterium and Streptomyces lividans. The enzyme’s activity can be inhibited by steric effects, metal ions, or other compounds. (3S)-3-(tert-Butoxycarbonyl)amino-1-chloro-4-phenyl-2-butanone crystallizes in two forms: one with the chiral center at the 3 position and one with it at the 4 position.</p>Pureza:Min. 95%PAR-2 (1-6) amide (mouse, rat) trifluoroacetate salt
CAS:<p>PAR-2 agonist is a synthetic peptide that activates PAR-2. It binds to PAR-2 receptors, which are present in the mesenteric vasculature and in various other tissues. Activation of PAR-2 leads to an increase in intracellular calcium concentration, activation of protein kinase C, cytosolic calcium ion release, phosphorylation of myosin light chain, muscle cell proliferation, transcription and translation initiation, and increased production of vasoactive intestinal peptide. This drug also has anti-inflammatory effects and stimulates epidermal growth factor (EGF) and thrombin receptor expression as well as growth factor production.</p>Fórmula:C29H56N10O7Pureza:Min. 95%Peso molecular:656.82 g/mol1-Chlorobenzotriazole
CAS:<p>1-Chlorobenzotriazole is a nucleophilic reagent that can be used in analytical chemistry, such as the determination of propranolol hydrochloride. It reacts with phospholipid membranes by transferring a chlorine atom to the hydroxyl group on the lipid molecule. The reaction mechanism is not well understood, but it has been shown that the deuterium isotope effect is not involved in this reaction. 1-Chlorobenzotriazole is unsymmetrical and can react with both acidic and alkaline solutions. Hydrochloric acid is often used to activate this compound, which will then react with an amine group to form an iminium ion. Kinetics data for this compound show that activation energies are required for reactions involving nucleophiles, such as ketones, alcohols, or amines.</p>Fórmula:C6H4ClN3Pureza:Min. 95%Peso molecular:153.57 g/molDnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H64N14O11Pureza:Min. 95%Peso molecular:977.08 g/molBis(cyclopentadienyl)titanium (IV) dichloride
CAS:<p>Bis(cyclopentadienyl)titanium (IV) dichloride is a cationic polymerization catalyst that has been used to produce polyolefins with high molecular weights. It is also an important component of solid catalysts for the production of butadiene and styrene. Bis(cyclopentadienyl)titanium (IV) dichloride is a potent carcinogen in animals and is mutagenic in bacteria. It has been shown to cause cancer in animal models, and has been shown to be mutagenic in bacterial mutation assay tests. Bis(cyclopentadienyl)titanium (IV) dichloride reacts with dimethylformamide and aromatic hydrocarbons to produce photochemical properties that can lead to skin irritation or sensitization. This compound also has hydroxyl groups, which can react with oxidants such as chlorine gas to form chlorohydrins, which are toxic compounds that may be carcinogenic.</p>Fórmula:C10H10TiCl2Pureza:Min. 95%Forma y color:Red Clear LiquidPeso molecular:248.96 g/mol1,3-Bis[4-chloro-3-(trifluoromethyl)phenyl]urea
CAS:<p>Covid-19 is a drug repositioning agent that has been shown to be effective against a number of microorganisms, including influenza A virus (H1N1) and the pandemic strain. Covid-19 is an efficient antimicrobial agent with activity against both Gram-positive and Gram-negative bacteria, as well as fungi. Covid-19 has also been shown to have antiviral properties against the human rhinovirus type 2 (HRV2). Covid-19 can be used for wastewater treatment because it can eliminate a broad spectrum of microorganisms. It also has anti-inflammatory properties, which may make it useful in animal health applications. Covid-19 could also be used in ecological systems because it is not toxic to plants or animals. Covid-19 is synthetically produced and can bind to antibodies that are specific to certain viruses or bacteria. Covid-19 has no known toxicity in mammals.</p>Fórmula:C15H8Cl2F6N2OPureza:Min. 95%Peso molecular:417.13 g/molCortistatin-17 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cortistatin-17 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C96H139N27O24S3Pureza:Min. 95%Peso molecular:2,151.5 g/mol5,6-Dichloropyridazin-3(2H)-one
CAS:<p>Please enquire for more information about 5,6-Dichloropyridazin-3(2H)-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C4H2Cl2N2OPureza:Min. 95%Peso molecular:164.98 g/molPAR-2 (1-6) (human) trifluoroacetate salt
CAS:<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/mol2,2,2-Trifluoro-1-(3-Trimethylsilylphenyl)Ethanone
CAS:<p>2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone is a chemical that can be used as an acetylcholinesterase inhibitor. This agent is designed to inhibit the enzyme that breaks down acetylcholine, which is responsible for transmitting nerve impulses and controlling muscle contractions. The activity of 2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone is reversible by hydrolysis and it has a low bioavailability due to its high lipophilicity. Acetylcholinesterase inhibitors are mainly used for the treatment of inflammatory diseases such as rheumatoid arthritis. br> The pharmacodynamics of 2,2,2-Trifluoro-1-(3-trimethylsilylphenyl)ethanone are not well understood. This drug also has side effect profiles</p>Fórmula:C11H13F3OSiPureza:Min. 95%Peso molecular:246.3 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Fórmula:C50H80N14O14SPureza:Min. 95%Peso molecular:1,133.32 g/molAbz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C69H114N26O18Pureza:Min. 95%Peso molecular:1,595.81 g/molMyelin Basic Protein (83-99) (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C93H143N25O24Pureza:Min. 95%Peso molecular:1,995.28 g/mol3-Amino-2-bromo-6-chloropyridine
CAS:<p>Please enquire for more information about 3-Amino-2-bromo-6-chloropyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C5H4BrClN2Pureza:Min. 95%Peso molecular:207.46 g/molAtrial Natriuretic Factor (5-27) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C97H154N34O32S3Pureza:Min. 95%Peso molecular:2,404.67 g/molEnterotoxin STp (E. coli) trifluoroacetate salt
CAS:Producto controlado<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C81H110N20O26S6Pureza:Min. 95%Peso molecular:1,972.26 g/mol(alphaR)-α-[[[2-(4-Nitrophenyl)ethyl]amino]methyl]benzenemethanol hydrochloride
CAS:<p>Intermediate in the synthesis of mirabegron</p>Fórmula:C16H18N2O3·HClPureza:Min. 95%Peso molecular:322.79 g/mol8-Chloroimidazo[1,2-a]pyrazine
CAS:<p>Please enquire for more information about 8-Chloroimidazo[1,2-a]pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C6H4ClN3Pureza:Min. 95%Peso molecular:153.57 g/molH-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ser(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%H-Lys-Pro-OH hydrochloride salt
CAS:<p>H-Lys-Pro-OH hydrochloride salt is a monoclonal antibody that is used to treat psychotic disorders. It blocks the binding of gamma-aminobutyric acid (GABA) to its receptor, which reduces neuronal activity and has a calming effect on the central nervous system. H-Lys-Pro-OH hydrochloride salt also inhibits the phosphatase enzyme and prevents it from breaking down phosphotungstic acid, which is used in this process. The antibody also binds to the analog of gamma aminobutyric acid, preventing it from binding with its receptor. H-Lys-Pro-OH hydrochloride salt may be advantageous in treating kidney fibrosis because it prevents cell proliferation and growth in tissue cultures by inhibiting enzymes involved in collagen synthesis. H-Lys-Pro-OH hydrochloride salt may also be useful as an antitumor agent because it inhibits tumor growth by blocking uptake and replication of DNA.</p>Fórmula:C11H21N3O3Pureza:Min. 95%Peso molecular:243.3 g/mol(Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr(Me)21)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C190H287N55O57SPureza:Min. 95%Peso molecular:4,285.71 g/mol(Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Phe1,Ser2,Tyr6)-PAR-1 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C39H60N10O8Pureza:Min. 95%Peso molecular:796.96 g/mol(D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C55H78N14O11Pureza:Min. 95%Peso molecular:1,111.3 g/mol(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester
CAS:<p>(S)-9,10-Difluoro-2,3-dihydro-3-methyl-7-oxo-7H-pyrido[1,2,3-de]-1,4-benzoxazine-6-carboxylic acid ethyl ester is an acidic substance that can be produced by the amination of piperazine with chloroacetic acid. The reaction solution is heated to a temperature of about 120°C for about 30 minutes and then cooled to room temperature. The product precipitates as a white solid. This compound has been shown to have antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA) in plates.</p>Fórmula:C15H13F2NO4Pureza:Min. 95%Peso molecular:309.26 g/mol1-(4,4'-Difluorobenzhydry)piperazine
CAS:<p>1-(4,4'-Difluorobenzhydry)piperazine (1-DFBP) is a potential antitumor agent that has been shown to inhibit the growth of leukemia cells. It may be an inhibitor of apoptotic cell death, as it has been shown to induce hydrogen bond formation with coumarin derivatives. 1-DFBP has also been shown to have inhibitory activities against leukemia HL-60 cells, and is a competitive inhibitor of cinnarizine. The catalytic mechanism for 1-DFBP is not known, although kinetic data suggest that it involves hydrogen bonding and/or pi stacking interactions.</p>Fórmula:C17H18F2N2Pureza:Min. 95%Peso molecular:288.34 g/mol2-Amino-4-fluorobenzonitrile
CAS:<p>2-Amino-4-fluorobenzonitrile is a chemical compound that can be used as a radioprotectant. It is also an intermediate in the synthesis of other compounds, such as methoxycyanamides and hypervalent amines. 2-Amino-4-fluorobenzonitrile has shown to have anti-tumour effects by scavenging free radicals. This chemical can be used to produce formic acid or bisphosphonates.</p>Fórmula:C7H5FN2Pureza:Min. 95%Forma y color:PowderPeso molecular:136.13 g/mol3-Chloro-2,5-dibromopyridine
CAS:<p>3-Chloro-2,5-dibromopyridine is a fine chemical that is used as a building block in the synthesis of other chemicals. It is a reagent and speciality chemical with high quality and complex structure. 3-Chloro-2,5-dibromopyridine is a versatile building block that can be used in the synthesis of many different compounds and as an intermediate or scaffold for other reactions. It has been shown to react with various nucleophiles, such as amines, alcohols, and thiols.</p>Fórmula:C5H2Br2CINPureza:Min. 95%Forma y color:White/Off-White SolidPeso molecular:271.34 g/molAlloferon 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Alloferon 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C46H69N19O15Pureza:Min. 95%Peso molecular:1,128.16 g/molMethoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H41N9O9Pureza:Min. 95%Peso molecular:671.7 g/molBis[α,α-bis(trifluoromethyl)benzenemethanolato]diphenylsulfur
CAS:<p>A dehydration agent. Also called Martin Sulfurane Dehydrating agent</p>Fórmula:C30H20F12O2SPureza:Min. 95%Peso molecular:672.53 g/mol(D-Lys6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H84N18O13·xC2HF3O2Pureza:Min. 95%Forma y color:White To Off-White SolidPeso molecular:1,253.41 g/mol5-Bromo-2-(trifluoromethoxy)benzaldehyde
CAS:<p>5-Bromo-2-(trifluoromethoxy)benzaldehyde is a chemical that is used as a reactant in organic chemistry. It can be used as a building block for the synthesis of complex compounds, or as an intermediate in the preparation of fine chemicals. 5-Bromo-2-(trifluoromethoxy)benzaldehyde is also useful in research and development. It has been used to synthesize pharmaceuticals, pesticides, and other organic compounds.</p>Fórmula:C8H4BrF3O2Pureza:Min. 95%Forma y color:PowderPeso molecular:269.02 g/molPerfluoro-N-(4-methylcyclohexyl)piperidine
CAS:Producto controlado<p>Perfluoro-N-(4-methylcyclohexyl)piperidine (4-FPP) is a fluorine compound that has been shown to inhibit the enzymatic activity of tyrosine kinases. It is a potent inhibitor of both human and murine tyrosine kinases, but it does not bind to bacterial tyrosine kinase domains. 4-FPP has been used in clinical studies as an anti-cancer drug, although it's clinical relevance remains unclear. It has also been shown to be effective against the influenza virus by inhibiting the synthesis of viral proteins that are involved in replication. The chemical structure of 4-FPP contains a carbonyl group that can react with other compounds through a photochemical process. This reaction is thought to result in the development of new drugs with similar biochemical properties to 4-FPP.</p>Fórmula:C12F23NPureza:Min. 95%Forma y color:Clear LiquidPeso molecular:595.1 g/molMethyl 3-chloro-4-fluorobenzoate
CAS:<p>Methyl 3-chloro-4-fluorobenzoate is a white crystalline solid with a melting point of 61°C. It is soluble in ethyl acetate, ether, and chloroform. Methyl 3-chloro-4-fluorobenzoate is used as a reagent in the synthesis of polymers, pharmaceuticals, and pesticides. It has been shown to be useful as a building block for the synthesis of complex compounds such as heterocycles and polymers. Methyl 3-chloro-4-fluorobenzoate is also used as an intermediate in the production of other chemicals such as pharmaceuticals, catalysts, and herbicides.</p>Fórmula:C8H6ClFO2Pureza:Min. 95%Peso molecular:188.58 g/mol5-Bromoquinolin-6-amine
CAS:<p>Please enquire for more information about 5-Bromoquinolin-6-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C9H7BrN2Pureza:Min. 95%Peso molecular:223.07 g/mol4-Fluoroisoindoline HCl
CAS:<p>4-Fluoroisoindoline HCl is a versatile building block that can be used in the synthesis of complex compounds, research chemicals, and reagents. It is a high quality compound with a wide range of applications. 4-Fluoroisoindoline HCl is also useful as an intermediate for the synthesis of other compounds, or as a reaction component for organic chemistry reactions. This compound has been shown to have potential medical uses in the treatment of Parkinson's disease and cancer.</p>Fórmula:C8H8FN·HClPureza:Min. 95%Forma y color:White to brown solid.Peso molecular:173.61 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>Fórmula:C25H42N10O11SPureza:Min. 95%Peso molecular:690.73 g/mol4-Fluoro-4'-hydroxybiphenyl
CAS:<p>4-Fluoro-4'-hydroxybiphenyl is a reactive chemical that belongs to the group of halogenated hydrocarbons. It is used in the synthesis of medicines and has been shown to have high viscosity. 4-Fluoro-4'-hydroxybiphenyl can be synthesized by reacting with chloride in the liquid phase, resulting in a viscous liquid. This compound has also been used as an intermediate for the synthesis of other compounds. 4-Fluoro-4'-hydroxybiphenyl is used as a ligand for metal complexes and reacts with phosphine to form a phosphine oxide, which is then converted into a crystal compound. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit prostaglandin synthesis.</p>Fórmula:C12H9FOPureza:Min. 95%Peso molecular:188.2 g/molMyeloblastin (142-150) (human, mouse) trifluoroacetate salt
CAS:<p>Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr-Val-OH trifluoroacetate salt is an antigen that belongs to the class of serine proteinases. It is a soluble recombinant human proteinase that has been shown to have a tumor cell lysis activity in vitro and in vivo. Myeloblastin (142-150) (human, mouse) trifluoroacetate salt HVal-Leu-Gln-Glu-Leu-Asn-Val-Thr Val is also a leukocyte antigen and can be used for the development of cancer vaccines.</p>Fórmula:C45H79N11O15Pureza:Min. 95%Peso molecular:1,014.17 g/molH-Pro-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Pro-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%ChloroformamidineHydrochloride
CAS:<p>ChloroformamidineHydrochloride is an inorganic acid that has a nitrogen atom and a chlorine atom. It is a polymer that is used in the film-forming industry. ChloroformamidineHydrochloride has been shown to be toxicological studies, with tests involving the film forming properties of this molecule. It also has biological properties and can target enzymes such as toll-like receptors and streptococcus faecalis, which are present on the surface of cells. ChloroformamidineHydrochloride can be reacted with creatine to form a molecule called thymidylate, which is needed for DNA synthesis and repair.</p>Fórmula:CH4Cl2N2Pureza:Min. 95%Peso molecular:114.96 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Fórmula:C27H36N10O10Pureza:Min. 95%Peso molecular:660.64 g/molDABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS:<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C76H98N16O15SPureza:Min. 95%Peso molecular:1,507.76 g/mol4-Chloro-2-(trifluoromethoxy)aniline
CAS:<p>4-Chloro-2-(trifluoromethoxy)aniline is a fine chemical that is used as a building block in the synthesis of other chemicals, such as pharmaceuticals and agrochemicals. It is also used in research as a reagent for organic synthesis and as a speciality chemical. 4-Chloro-2-(trifluoromethoxy)aniline has versatile applications in the manufacture of complex compounds, intermediates, and scaffolds.</p>Fórmula:C7H5ClF3NOPureza:Min. 95%Peso molecular:211.57 g/mol(Val5)-Angiotensin I trifluoroacetate salt
CAS:<p>Angiotensin I is a peptide that belongs to the class of substances called angiotensins. This substance is found in many tissues and organs, including the brain, adrenal gland, and lung. Angiotensin I has been shown to be a pressor agent and also has biochemical effects on amino acid composition. The c-terminal sequence of this substance has been determined by incubating the molecule with pepsin at different pH values. The molecular weight of this substance is 938 Da and it has an amino acid composition of Asp-Arg-Val-Tyr-Val-His-Pro-Phe-His-Leu.</p>Fórmula:C61H87N17O14Pureza:Min. 95%Peso molecular:1,282.45 g/molZ-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a small molecule that has been shown to induce apoptosis in cultured cells. It is a caspase-3 inhibitor, which prevents the activation of the caspase cascade and protects cells from oxidative injury. Low doses of Z-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone have been shown to induce apoptosis in cultured cells, with no significant cytotoxicity at high doses. The mechanism of action for this agent is not yet known, but it may promote mitochondrial membrane potential loss and neuronal death by binding to DNA, or induce cell death through a caspase-independent pathway.</p>Fórmula:C30H41FN4O12Pureza:Min. 95%Peso molecular:668.66 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H295N55O51S2Pureza:Min. 95%Peso molecular:4,217.84 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C124H188N36O33SPureza:Min. 95%Peso molecular:2,743.11 g/mol4-Chlorophenethyl alcohol
CAS:<p>4-Chlorophenethyl alcohol is a synthetic, primary alcohol. It can be synthesized by reacting 2,4-dichlorobenzoic acid with a Grignard reagent. The reaction produces 4-chlorophenethyl alcohol, which is insoluble in water and reacts with chloride to form chloroform. This procedure can be used to produce other chlorinated alcohols. 4-Chlorophenethyl alcohol has been shown to have acute toxicities that are similar to those of trifluoroacetic acid and it is believed that the toxicity is due to its ability to react with proteins and nucleic acids.</p>Fórmula:C8H9ClOPureza:Min. 95%Forma y color:PowderPeso molecular:156.61 g/mol([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about ([13C6]Leu5)-Ghrelin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%4-Difluoromethoxyphenylboronic acid pinacol ester
CAS:<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H17BF2O3Pureza:Min. 95%Peso molecular:270.08 g/mol2,4,5-Trifluorobenzoic acid
CAS:<p>2,4,5-Trifluorobenzoic acid is a synthetic compound that is used as an organic solvent. It has been detected in the environment at low concentrations, but can be detected by gas chromatography. 2,4,5-Trifluorobenzoic acid is also used in the synthesis of fluoroquinolones and other pharmaceuticals. The detection time for 2,4,5-trifluorobenzoic acid is about one day. This compound can be decarboxylated to produce benzoic acid and hydrogen fluoride (HF). 2,4,5-Trifluorobenzoic acid decomposes to form chlorine gas when heated with hydrochloric acid or sodium hypochlorite. This substance reacts with copper oxide and forms copper trifluoride. Analytical methods for this compound include ionisation mass spectrometry and expressed gas analysis.</p>Fórmula:C7H3F3O2Pureza:Min. 95%Forma y color:PowderPeso molecular:176.09 g/molIron(III) trifluoromethanesulfonate
CAS:<p>Iron trifluoromethanesulfonate is an inorganic compound that is used as a catalyst in organic reactions. It is a salt of iron(III) and triflic acid, with the formula Fe(O)(CF). It has been shown to be a cocatalyst for benzofuran derivatives and can be used to synthesize methyl ketones, alkylation products, diarylmethanes, primary alcohols, and cleavage products. Iron trifluoromethanesulfonate can also be used as a control experiment to study reaction mechanisms.</p>Fórmula:C3F9FeO9S3Pureza:Min. 95%Forma y color:White SolidPeso molecular:503.06 g/mol4-Amino-6-chloro-1,3-benzenedisulfonamide
CAS:<p>4-Amino-6-chloro-1,3-benzenedisulfonamide is a natural substance that has been used in Chinese medicine preparations for the treatment of cardiac problems. It belongs to the class of organic compounds called benzenedisulfonamides. 4-Amino-6-chloro-1,3-benzenedisulfonamide is produced by the bacterial enzyme aminase from amino acid and benzoic acid. The adsorption mechanism of 4-Amino-6-chloro-1,3-benzenedisulfonamide is not fully understood, but it is believed that the benzyl groups are key players in this process. The high affinity of 4-Amino-6-chloro1,3 benzenedisulfonamide to proteins may be due to its ability to form hydrogen bonds with protein side chains, such as serine or threonine residues. 4 Amino</p>Fórmula:C6H8ClN3O4S2Pureza:Min. 95%Forma y color:White To Light Brown SolidPeso molecular:285.73 g/molOrphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P518 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C127H195N37O37Pureza:Min. 95%Peso molecular:2,832.13 g/molAcetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(3,4-dehydro-Pro1,4-fluoro-D-Phe2,D-Trp3·6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C69H85FN16O13Pureza:Min. 95%Peso molecular:1,365.51 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C221H368N72O66SPureza:Min. 95%Peso molecular:5,121.8 g/mol2,3-Dibromo-N-methylmaleimide
CAS:<p>2,3-Dibromo-N-methylmaleimide is a synthetic compound that can be used as an anticancer agent. It inhibits the proliferation of endothelial cells and induces apoptosis in cancer cells. The molecular structure of 2,3-Dibromo-N-methylmaleimide is similar to bisindolylmaleimides, which are naturally occurring compounds found in plants. 2,3-Dibromo-N-methylmaleimide is synthesized by cross coupling with magnesium and hydroxyl group using a vibrational spectroscopy technique called nmr spectra. This molecule also has amine groups that can be used for drug conjugation or activation.</p>Fórmula:C5H3Br2NO2Pureza:Min. 95%Peso molecular:268.89 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Fórmula:C11H16ClNO3Pureza:Min. 95%Forma y color:White to off white solid.Peso molecular:245.7 g/molAcetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C116H176N26O30S2Pureza:Min. 95%Peso molecular:2,478.93 g/mol5-Chloro-2,1,3-benzothiadiazole
CAS:<p>5-Chloro-2,1,3-benzothiadiazole is a drug substance that belongs to the group of benzothiadiazoles. It is an organic solvent that is used in the chloromethylation of aromatic compounds and as a chromatographic reagent. 5-Chloro-2,1,3-benzothiadiazole has been used in research studies on the chlorination of acetonitrile and chloride. This drug is synthesized by reacting benzene with selenium dioxide and sodium hydroxide. 5-Chloro-2,1,3-benzothiadiazole can be produced by reacting benzene with nitromethane and oxalic acid or by heating phthalic anhydride with a solution of potassium hydroxide in acetonitrile. The liquid chromatography method is used to separate this drug from impurities such as monochloride,</p>Fórmula:C6H3ClN2SPureza:Min. 95%Peso molecular:170.62 g/molpTH (1-84) (rat) trifluoroacetate salt
<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C406H670N122O126S3Pureza:Min. 95%Peso molecular:9,372.61 g/molBiotinyl-MCH (salmon) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C99H153N29O26S5Pureza:Min. 95%Peso molecular:2,325.78 g/mol4,5-Dibromo-1,2,6,7-tertahydro-8H-indeno[5,4-b]furan-8-one
CAS:<p>4,5-Dibromo-1,2,6,7-tertahydro-8H-indeno[5,4-b]furan-8-one is a chemical reagent that is used for the debromination of ethyl cyanoacetate. The nucleophilic nature of the hydroxyl group in the target compound makes it an efficient substrate for this reaction. This reagent can be used to synthesize ramelteon which is a drug approved by the U.S. Food and Drug Administration (FDA) for insomnia treatment. This high yield synthesis highlights 4,5-dibromo-1,2,6,7-tertahydro-8H-indeno[5,4b]furan-8one's usefulness as a debrominating agent.</p>Fórmula:C11H8Br2O2Pureza:Min. 95%Peso molecular:331.99 g/mol(D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C196H288N56O56SPureza:Min. 95%Peso molecular:4,356.79 g/mol3-(3,4-dichlorophenyl)propanoic acid
CAS:<p>3-(3,4-Dichlorophenyl)propanoic acid is a potent inhibitor of the lysine methyltransferase enzyme. This enzyme catalyzes the transfer of methyl groups from S-adenosylmethionine to lysine residues in proteins, and it is involved in cancer cell proliferation. 3-(3,4-Dichlorophenyl)propanoic acid inhibits the activity of this enzyme by covalently binding to lysine residues on the protein and preventing their methylation. Research has shown that 3-(3,4-Dichlorophenyl)propanoic acid can block tumor growth by inhibiting the activity of this enzyme.</p>Fórmula:C9H8O2Cl2Pureza:Min. 95%Forma y color:PowderPeso molecular:219.06 g/molH-Ala-Pro-pNA hydrochloride salt
CAS:<p>H-Ala-Pro-pNA hydrochloride salt is a protease inhibitor that is used as a therapeutic agent for the treatment of hepatitis C. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, by binding to their active site. H-Ala-Pro-pNA hydrochloride salt also inhibits the activity of DPPIV (dipeptidyl peptidase IV), which is an enzyme that cleaves the third amino acid from peptides in some blood cells. H-Ala-Pro-pNA hydrochloride salt has been shown to be effective in preventing diabetic nephropathy in animal models by inhibiting DPPIV activity.<br>H-Ala-Pro-pNA hydrochloride salt can be used to treat chronic hepatitis B and C infections. It binds to virus particles and prevents them from attaching themselves to host cells, thus preventing viral replication.</p>Fórmula:C14H18N4O4Pureza:Min. 95%Peso molecular:306.32 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C159H267N49O43Pureza:Min. 95%Peso molecular:3,553.13 g/molH-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H71ClN12O8S2Pureza:Min. 95%Peso molecular:1,175.86 g/mol3,5-Dichlorobenzenesulphonyl chloride
CAS:<p>3,5-Dichlorobenzenesulphonyl chloride (3,5-DCBS) is a halogenated aromatic compound that can be synthesized by the debromination of 3,5-dichlorobenzene with hydrobromic acid. This compound has been shown to have anticancer activity against cell lines derived from human breast cancer, prostate cancer, and other cancers. It also has potent anticancer activity against tumor cells in animals. The anticancer activity of 3,5-DCBS is due to its ability to inhibit DNA synthesis and to induce apoptosis. 3,5-DCBS may act as an anti-inflammatory agent through inhibition of prostaglandin synthesis.</p>Fórmula:C6H3Cl3O2SPureza:Min. 95%Forma y color:PowderPeso molecular:245.51 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C86H125N27O29Pureza:Min. 95%Peso molecular:2,001.08 g/molArg-Glu(EDANS)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt
CAS:<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C91H129N25O25SPureza:Min. 95%Peso molecular:2,005.22 g/molZ-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone
<p>Please enquire for more information about Z-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C32H46FN5O11Pureza:Min. 95%Peso molecular:695.73 g/molSalusin-β (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Salusin-beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C115H176N32O21Pureza:Min. 95%Peso molecular:2,342.83 g/mol1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd.
CAS:<p>1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd. is a cosmetically active organic solvent that is used as an ingredient in cosmetic products. It is also used as a raw material for the production of polymer films. 1,1,2,3,3,3-Hexafluoro-1-propene oxidized polymd. has been shown to be effective in preventing calcium carbonate from agglomerating and provides a constant viscosity in water. This product can also be used as a film-forming polymer with anti-fogging properties. The product also has nutritional supplement properties and can be found in dietary supplements such as fish oil capsules or vitamin E pills.</p>Pureza:Min. 95%Forma y color:Clear Liquid3-Methylpentyl chloroformate
CAS:<p>Please enquire for more information about 3-Methylpentyl chloroformate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C7H13ClO2Pureza:Min. 95%Peso molecular:164.63 g/mol4-Chlorophenyl-2-pyridinylmethanol
CAS:<p>Please enquire for more information about 4-Chlorophenyl-2-pyridinylmethanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H10ClNOPureza:Min. 95%Peso molecular:219.67 g/molM65 trifluoroacetate salt
<p>Please enquire for more information about M65 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C205H326N64O61S5Pureza:Min. 95%Peso molecular:4,823.51 g/molNeuropeptide Y (2-36) (human, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Neuropeptide Y (2-36) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C180H276N54O55SPureza:Min. 95%Peso molecular:4,108.51 g/mol6-Fluoro-3,4-Pyridinediamine
CAS:<p>Please enquire for more information about 6-Fluoro-3,4-Pyridinediamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C5H6FN3Pureza:Min. 95%Peso molecular:127.12 g/mol1-(Chloroacetyl)-2-(trifluoroacetyl)hydrazine
CAS:<p>Please enquire for more information about 1-(Chloroacetyl)-2-(trifluoroacetyl)hydrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C4H4ClF3N2O2Pureza:Min. 95 Area-%Forma y color:White PowderPeso molecular:204.53 g/molLys-(Des-Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Lys-(Des-Arg9)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-OH trifluoroacetate salt (KBP) is a peptide that increases blood pressure by binding to the b2 receptor. This drug has been shown to be a potent pressor in animals and humans, with a concentration response curve similar to that of epinephrine. KBP binds to the extracellular domain of the b2 receptor, which activates this receptor and promotes the release of growth factors, such as epidermal growth factor (EGF). The high affinity of KBP for the b2 receptor is thought to be due to its ability to sequester EGF.</p>Fórmula:C50H73N13O11Pureza:Min. 95%Peso molecular:1,032.2 g/mol5-Chloro-2-formylpyridine
CAS:<p>5-Chloro-2-formylpyridine is a peroxide that reacts with pyridine rings to form epoxides. It has been shown to be a potent oxidant and is used in the synthesis of epoxides. 5-Chloro-2-formylpyridine can also react with imidazoles and form tetradentate ligands, which are compounds that bind to metals. This chemical has selectivity for carboxylic acid groups, hydrogen peroxide, alkene, and piperazine. Irradiation of 5-chloro-2-formylpyridine yields an epoxide group on the pyridine ring.</p>Fórmula:C6H4NOClPureza:Min. 95%Peso molecular:141.55 g/mol2-Chloroacetamide
CAS:<p>2-Chloroacetamide is a quaternary ammonium compound that is used as an intermediate in the synthesis of other organic compounds. It has been reported to have anticancer activity and has been studied for use as a herbicide in agriculture. The vibrational, turbidimetric method, amide, and sample preparation are all instrumental in determining the reaction mechanism of 2-chloroacetamide. This molecule has also been studied using FT-IR spectroscopy and molecular modelling techniques. The hydrogen bond is integral to its optical properties and can be determined by nmr spectra.</p>Fórmula:C2H4ClNOPureza:Min. 98%Forma y color:White PowderPeso molecular:93.51 g/mol5-Bromoquinolin-8-amine
CAS:<p>5-Bromoquinolin-8-amine is a topoisomerase inhibitor that can be used as an antitumor agent. It has been shown to inhibit the growth of tumor cell lines and suppress the growth of colon carcinoma cells in rats and human colon carcinomas in mice. 5-Bromoquinolin-8-amine interacts with DNA, specifically inhibiting the formation of supercoiled DNA. This interaction may lead to the inhibition of tumor cell growth. 5-Bromoquinolin-8-amine also inhibits protein synthesis by interacting with proteins at the ribosomal level, leading to inhibited cell growth.</p>Fórmula:C9H7BrN2Pureza:Min. 95%Peso molecular:223.07 g/molBiotinyl-epsilonAhx-ω-Conotoxin GVIA trifluoroacetate salt
CAS:Producto controlado<p>Please enquire for more information about Biotinyl-epsilonAhx-omega-Conotoxin GVIA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C136H207N41O46S7Pureza:Min. 95%Peso molecular:3,376.81 g/molProcaine hydrochloride
CAS:Producto controlado<p>Sodium channel blocker</p>Fórmula:C13H21ClN2O2Forma y color:PowderPeso molecular:272.77 g/molH-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H32N8O9Pureza:Min. 95%Peso molecular:504.5 g/molEndothelin-2 (human, canine) trifluoroacetate
CAS:<p>Trifluoroacetate salt</p>Fórmula:C115H160N26O32S4Pureza:Min. 95%Peso molecular:2,546.92 g/molR-(-)-3-Quinuclidinyl chloroformate
CAS:<p>R-(-)-3-Quinuclidinyl chloroformate is a chemical intermediate that is used as a reagent in organic synthesis. It reacts with amines to form quaternary ammonium salts, which are often used as reaction components in the production of pharmaceuticals. R-(-)-3-Quinuclidinyl chloroformate has been shown to be useful for the preparation of various heterocycles. This compound has been found to have several biological activities, including the ability to inhibit protein synthesis and induce apoptosis.</p>Fórmula:C8H12ClNO2Pureza:Min. 95%Forma y color:White PowderPeso molecular:189.64 g/mol3,5-Dichloro-4-methylpyridine
CAS:<p>Please enquire for more information about 3,5-Dichloro-4-methylpyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C6H5Cl2NPureza:Min. 95%Peso molecular:162.02 g/mol4-Bromo-6-chloropyridazin-3(2H)-one
CAS:<p>4-Bromo-6-chloropyridazin-3(2H)-one is a glycosylation inhibitor and nucleoside analog that can be used in the treatment of cancer. It inhibits the synthesis of deoxyribonucleotides from ribonucleotides by binding to the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxynucleotides. 4-Bromo-6-chloropyridazin-3(2H)-one has been shown to inhibit glycosylation in rat liver cells. This drug also inhibits acetone and glycosidation, which are reactions that produce glucose from amino acids or carbohydrates. The crystallization process is also inhibited by this drug because it prevents the formation of nucleoside crystals, which are involved in DNA replication and cell division.</p>Fórmula:C4H2BrClN2OPureza:Min. 95%Peso molecular:209.43 g/molH-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh)
<p>Please enquire for more information about H-Arg(Pbf)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate
CAS:<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C165H252N44O48S•(C2HF3O2)xPureza:Min. 95%Peso molecular:3,652.1 g/molTyr-Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C77H116N20O19SPureza:Min. 95%Peso molecular:1,657.93 g/mol2-Chloro-4-iodopyridine
CAS:<p>2-Chloro-4-iodopyridine is an antibacterial agent that inhibits bacterial growth by interfering with the synthesis of folic acid. It has been shown to be effective against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. 2-Chloro-4-iodopyridine is a ligand that binds to metal ions such as copper and silver. The transfer of electrons from the metal ion to the ligand facilitates the cross-coupling reaction in organic synthesis. Cross-coupling reactions are also used in devices such as solar cells and hydrogen fuel cells.<br>2-Chloro-4-iodopyridine can also be used for photophysical experiments with single crystal x-ray diffraction studies.</p>Fórmula:C5H3ClINPureza:Min. 95%Forma y color:White PowderPeso molecular:239.44 g/molMeOSuc-Ala-Ala-Pro-Val-chloromethylketone
CAS:<p>MeOSuc-Ala-Ala-Pro-Val-chloromethylketone is a serine protease inhibitor that has been shown to be effective against influenza virus and HIV. It was found to be active against a number of serine proteases, such as trypsin, chymotrypsin, and elastase. MeOSuc-Ala-Ala-Pro-Val-chloromethylketone also has chemotactic activity in thp1 cells and lung fibroblasts. It is activated by the addition of water and has been shown to inhibit the growth of soybean trypsin. However, it does not have any effect on human trypsin.</p>Fórmula:C22H35ClN4O7Pureza:Min. 95%Peso molecular:502.99 g/molSomatostatin-14 (3-14) trifluoroacetate salt
CAS:<p>Please enquire for more information about Somatostatin-14 (3-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C71H96N16O17S2Pureza:Min. 95%Peso molecular:1,509.75 g/molPropamocarbHydrochloride
CAS:<p>Propamocarb hydrochloride is a crystalline polymorph that has been found to be active against the bacterial strain. The mechanism of action is not yet known, but it may be due to inhibition of the enzyme carboxypeptidase A and/or an unknown biological function. Propamocarb hydrochloride has shown no significant toxicity in animal studies up to a dose of 2000 mg/kg. This compound has been studied as a potential treatment for tissue damage caused by inflammation and disease. In vitro experiments have shown that propamocarb hydrochloride is effective at inhibiting the growth of cancer cells in tissue culture, with high values (IC50) being seen at concentrations of 1-10 μM.</p>Fórmula:C9H21ClN2O2Pureza:Min. 95%Peso molecular:224.73 g/mol(p-Chloro-D-Phe6,Leu17)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:<p>VIP is a potent vasoactive neuropeptide that is found in the heart, brain, and gut. It has been shown to be a potent inhibitor of guanethidine-induced contractions in the femoral vein, as well as atrial contractions. VIP also inhibits spontaneous contractions in the fundic region of the stomach and intestinal motility. VIP has been shown to inhibit vasoactive intestinal polypeptide-induced contractions in isolated rat ileum. VIP is expressed primarily in the enteric nervous system and throughout the gastrointestinal tract.</p>Fórmula:C148H239ClN44O42Pureza:Min. 95%Peso molecular:3,342.21 g/molPhenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human)
CAS:<p>Please enquire for more information about Phenylacetyl-(D-Arg2·28,p-chloro-Phe6,Arg9, Abu 15, Nle 27, Homoarg 29)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C170H280ClN53O41Pureza:Min. 95%Peso molecular:3,757.83 g/molH-Ile-2-chlorotrityl resin (200-400 mesh)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%1-(Dibromomethyl)-4-nitrobenzene
CAS:<p>1-(Dibromomethyl)-4-nitrobenzene is a chemical substance that belongs to the group of industrial chemicals. It has been classified as toxic and hazardous for human health, with an expansion potential. This substance is used in the production of a number of insecticides and other chemical control agents. The toxic effects of 1-(dibromomethyl)-4-nitrobenzene are related to its alkaline properties and include irritation of the eyes, skin, and respiratory tract; central nervous system depression; liver damage; kidney damage; and gastrointestinal disturbances. Inhalation may result in pulmonary edema or death due to oxygen deprivation. This chemical is also known to cause cancer in animals.</p>Fórmula:C7H5Br2NO2Pureza:Min. 95%Peso molecular:294.93 g/mol5'-(6-Fluorescein) phosphoramidite
CAS:<p>5'-(6-Fluorescein) phosphoramidite is an oligonucleotide that can be used to label other molecules. It is a synthetic, cellular moiety that functions as a glycoconjugate and binds to the receptor-mediated endocytosis pathway. It is taken up by cells via a mechanism involving hyaluronic acid, which is also involved in receptor-mediated endocytosis. 5'-(6-Fluorescein) phosphoramidite has been shown to have the ability to bind to disaccharides and form complexes with them. This property may be useful in studying the uptake of glycoconjugates into cells.</p>Fórmula:C46H58N3O10PPureza:Min. 95%Peso molecular:843.94 g/molThymosin α1 trifluoroacetate salt
CAS:<p>Please enquire for more information about Thymosin alpha1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C129H215N33O55·xC2HF3O2Pureza:Min. 95%Peso molecular:3,108.28 g/molFibrinopeptide A (human) trifluoroacetate salt
CAS:<p>Fibrinopeptide A is a peptide that is released from the fibrinolysis of fibrinogen. It can be used as a blood marker for the diagnosis of bowel disease and primary pulmonary hypertension, but not for other diseases such as infectious diseases. Fibrinopeptide A has been shown to be an effective model system for studying thrombin-mediated fibrin polymerization in vitro. This drug also can be used as a tool for investigating the disulfide bond in fibrinogen.</p>Fórmula:C63H97N19O26Pureza:Min. 95%Peso molecular:1,536.56 g/mol(Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys3, Nle 4,Arg5,D-2-Nal 7,Cys11)-a-MSH (3-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H76N18O9S2Pureza:Min. 95%Peso molecular:1,209.45 g/molDiphenyl(4-phenylthio)phenylsufonium hexafluorophosphate
CAS:<p>Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate is a photoinitiator that is used in photopolymerization. It absorbs light at around 800 nm and emits light at around 810 nm. The initiator has a low molecular weight and is soluble in organic solvents, which makes it suitable for polymerization of acrylate monomers. Diphenyl(4-phenylthio)phenylsufonium hexafluorophosphate can be synthesized by the reaction of diphenyliodonium hexafluorophosphate with phenyldithiocarbonyl chloride.</p>Fórmula:C24H19S2•PF6Pureza:Min. 95%Forma y color:PowderPeso molecular:516.5 g/mol3-Chloroquinoxaline-2-carboxylic acid
CAS:<p>3-Chloroquinoxaline-2-carboxylic acid is a synthetic compound that has been shown to have antimicrobial properties against bacteria. It is a quinoxaline derivative, which is an important class of compounds for the development of new antibiotics. 3-Chloroquinoxaline-2-carboxylic acid has been shown to inhibit bacterial growth through different mechanisms including blocking DNA synthesis, binding to RNA polymerase, and inhibiting protein synthesis. It also has been shown to be effective against drug resistant bacteria such as methicillin resistant Staphylococcus aureus (MRSA).</p>Fórmula:C9H5ClN2O2Pureza:Min. 95%Peso molecular:208.6 g/molNesfatin-1 (30-59) (human) trifluoroacetate salt
<p>Please enquire for more information about Nesfatin-1 (30-59) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C167H263N41O54Pureza:Min. 95%Peso molecular:3,709.12 g/molTRAP-7 trifluoroacetate salt
CAS:<p>TRAP-7 is a guanine nucleotide-binding protein that belongs to the polymerase chain reaction (PCR) family of DNA polymerases. It is a biocompatible polymer with physiological effects on basic fibroblast cells. TRAP-7 has been shown to have a role in the regulation of platelet activation, neuronal death, and thrombin receptor activity. The polyvinyl chloride (PVC) membrane used in this product is also biocompatible, and it can be used for applications such as cell culture surfaces and medical devices.</p>Fórmula:C39H63N11O10Pureza:Min. 95%Peso molecular:845.99 g/mol(Dibromomethyl)benzene
CAS:<p>Dibromomethylbenzene is a reactive, non-metallic chemical compound with the formula CHBr2. It is a colorless liquid that is soluble in water and has a strong odor. Dibromomethylbenzene can be used to treat wastewater by removing metals, such as iron and copper, that are not removed by conventional methods. This compound also has been shown to inhibit the growth of infectious bacteria, such as Salmonella enterica and Escherichia coli. Dibromomethylbenzene reacts with metal hydroxides to produce volatile bromide ions, which react with the carbohydrate to form cyclic peptides. These reactions are catalyzed by solid catalysts like activated carbon or alumina.</p>Fórmula:C7H6Br2Pureza:95%MinPeso molecular:249.93 g/molAmyloid b-Protein (6-20) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C86H119N23O23Pureza:Min. 95%Peso molecular:1,843.01 g/mol(3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid
CAS:<p>Please enquire for more information about (3R)-3-[(tert-Butoxycarbonyl)amino]-4-(2,4-difluorophenyl)butanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H19F2NO4Pureza:Min. 95%Peso molecular:315.31 g/mol2-Bromo-4,5-dimethoxybenzoic acid
CAS:<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>Fórmula:C9H9BrO4Pureza:Min. 95%Forma y color:PowderPeso molecular:261.07 g/mol3-Chlorophenyl acetic acid
CAS:<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>Fórmula:C8H7ClO2Pureza:Min. 95%Forma y color:PowderPeso molecular:170.59 g/molProinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about Proinsulin C-Peptide (31-63) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C142H239N47O46Pureza:Min. 95%Peso molecular:3,340.71 g/molEndothelin-1 (11-21) trifluoroacetate salt
CAS:<p>Endothelin-1 (11-21) trifluoroacetate salt H-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp is a peptide that is derived from endothelin. It has been shown to have an inhibitory effect on insulin stimulated glucose uptake in Sprague Dawley rats. This peptide has also been shown to bind to the endothelin receptor and act as a nonselective agonist. Endothelin 1 (11–21) trifluoroacetate salt H-Cys Val Tyr Phe Cys His Leu Asp Ile Ile Trp, when incubated with cells, had a maximal response at micron concentrations.</p>Fórmula:C68H92N14O15S2Pureza:Min. 95%Peso molecular:1,409.68 g/molFITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt
<p>Please enquire for more information about FITC-epsilonAhx-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C230H333N57O66S2Pureza:Min. 95%Peso molecular:5,016.58 g/mol2-Amino-6-fluorobenzoic acid ethyl ester
CAS:<p>2-Amino-6-fluorobenzoic acid ethyl ester is a chemical that can be used as a building block in the synthesis of more complex compounds. It is a versatile intermediate and can be used to synthesize other important compounds, such as pharmaceuticals. This compound has been shown to be useful for the preparation of 2-amino-4,6-difluorobenzoic acid ethyl ester and many other derivatives. The colorless solid is soluble in ether and dichloromethane.</p>Fórmula:C9H10FNO2Pureza:Min. 95%Forma y color:PowderPeso molecular:183.18 g/mol2,4-Dichloro-5-methoxyaniline
CAS:<p>2,4-Dichloro-5-methoxyaniline (2,4-DMA) is a trifluoroacetic acid derivative that inhibits the growth of cancer cells by interfering with cellular processes such as DNA replication and protein synthesis. It has been shown to have anticancer activity in vitro and in vivo. In addition, 2,4-DMA can inhibit the growth of cancer cells by preventing epidermal growth factor from binding to its receptor on the cell surface. A recent study showed that 2,4-DMA has anti-angiogenic properties and can prevent tumor growth by inhibiting bcr-abl kinase activity. 2,4-DMA also has an acidic property which may be due to its conversion of trifluoroacetic acid into hydrogen fluoride (HF) and hydrogen chloride (HCl).<br>2,4-Dichloro-5-methoxyaniline was approved for use in Japan</p>Fórmula:C7H7Cl2NOPureza:Min. 95%Forma y color:White To Pink SolidPeso molecular:192.04 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C60H100N22O14S3Pureza:Min. 95%Peso molecular:1,449.77 g/molBiotinyl-Neuropeptide W-23 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Neuropeptide W-23 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C129H197N37O30S2Pureza:Min. 95%Peso molecular:2,810.31 g/molBromofluoroacetic Acid
CAS:<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>Fórmula:C2H2BrFO2Pureza:Min. 95%Peso molecular:156.94 g/molDynorphin A (1-11) amide trifluoroacetate salt
CAS:<p>Dynorphin A (1-11) amide trifluoroacetate salt is a modified form of the opioid peptide dynorphin, which is a natural ligand for kappa-opioid receptors. It has affinity for the surface receptors and can be used to study the modifications that occur in cell function. Dynorphin A (1-11) amide trifluoroacetate salt has been shown to decrease cell function when it interacts with these surface receptors, which are found in brain homogenates and other tissues. Dynorphin A (1-11) amide trifluoroacetate salt also has an effect on brain cells, which may be due to its ability to alter conformational changes in proteins by binding to them. This can lead to alterations in the structure of certain enzymes or receptor proteins.</p>Fórmula:C63H104N22O12Pureza:Min. 95%Peso molecular:1,361.64 g/mol(2-Chlorophenyl)diphenylmethanol
CAS:<p>2-Chlorophenyl)diphenylmethanol is an antifungal drug that blocks the function of a calcium ionophore in fungal cells. It has been shown to be effective against a variety of filamentous fungi, including Aspergillus fumigatus, Candida albicans, and Trichosporon cutaneum. This drug is used as a topical antifungal agent for treatment of skin infections caused by these fungi. 2-Chlorophenyl)diphenylmethanol has been shown to have anti-inflammatory properties in animal models of kidney fibrosis and cell binding. Clinical data suggests that it can be used for the prevention or treatment of stem cell transplantation complications such as graft versus host disease and leukemia.</p>Fórmula:C19H15ClOPureza:Min. 95%Forma y color:PowderPeso molecular:294.77 g/mol(His(3-Me)2)-LHRH trifluoroacetate salt
CAS:<p>Please enquire for more information about (His(3-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C56H77N17O13·C2HF3O2Pureza:Min. 95%Peso molecular:1,310.34 g/molAc-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about Ac-Arg-Cys-Met-5-aminopentanoyl-Arg-Val-Tyr-5-aminopentanoyl-Cys-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C49H82N16O11S3Pureza:Min. 95%Peso molecular:1,167.47 g/molpTH (1-34) amide (human) trifluoroacetate salt
CAS:<p>Parathyroid hormone (PTH) is a peptide hormone that regulates calcium and phosphate balance in the body. PTH is secreted by the parathyroid glands, located near the thyroid gland in the neck. It is also known as parathormone or parathyrin. The active form of PTH, called pTH (1-34) amide, has been shown to stimulate bone resorption and to inhibit bone formation. The amino acid sequence of this hormone starts with arginine and ends with phenylalanine. The N-terminal amino acid residue is an aspartic acid or asparagine and histidine is the only basic residue in this molecule. This molecule has two acidic residues, glutamic acid and aspartic acid, which are found on the side chains of two amino acids: aspartic acid and glutamic acid. Valine is found at position 3 and phenylalanine at position 34.</p>Fórmula:C181H292N56O50S2Pureza:Min. 95%Peso molecular:4,116.73 g/mol(2E)-1-[5,6-Dihydro-3-(trifluoromethyl)-1,2,4-triazolo[4,3-a]pyrazin-7(8H)-yl]-4-(2,4,5-trifluorophenyl)-2-buten-1-one
CAS:<p>Please enquire for more information about (2E)-1-[5,6-Dihydro-3-(trifluoromethyl)-1,2,4-triazolo[4,3-a]pyrazin-7(8H)-yl]-4-(2,4,5-trifluorophenyl)-2-buten-1-one including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H12F6N4OPureza:95%NmrPeso molecular:390.28 g/mol2-[Chloro(4-chlorophenyl)methyl]-pyridine
CAS:<p>Please enquire for more information about 2-[Chloro(4-chlorophenyl)methyl]-pyridine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H9Cl2NPureza:Min. 95%Peso molecular:238.11 g/molN-α-Z-L-lysine methyl ester hydrochloride
CAS:<p>N-alpha-Z-L-lysine methyl ester hydrochloride is a preparation that is used as a methyl ester. It is an ester of lysine and methyl chloride. This product has a molecular weight of 170.16 g/mol and the chemical formula CH3CONHCH2CH(NH)CO2CH3. The structural data has not been confirmed by X-ray crystallography, but it can be assumed to be in the form of a zwitterion. N-alpha-Z-L-lysine methyl ester hydrochloride can be used for the synthesis of peptides, which are building blocks for proteins and enzymes. N-alpha-Z-L-lysine methyl ester hydrochloride is also used in the production of certain kinds of drugs and organic acids such as acetylsalicylic acid (aspirin).</p>Fórmula:C15H22N2O4·HClPureza:Min. 95%Peso molecular:330.81 g/molH-Lys-Gly-Gly-OH hydrochloride salt
CAS:<p>Histidine is a non-essential amino acid that has been shown to be involved in the regulation of cell growth and differentiation. It is also involved in the biosynthesis of nucleotides, collagen, and carnitine. Kinetic studies on histidine have been done by acetylation of histidine with acetic anhydride and pyridine. The kinetic method used was based on the reaction between histidine and p-nitrophenyl phosphate. The transfer reactions were performed with a strain containing lysine residues which were then adsorbed onto a surface-enhanced Raman spectroscopy (SERS) substrate. These experiments were performed using techniques such as resonance mass spectrometry (RMS), surface-enhanced Raman spectroscopy (SERS), and protonation selective mass spectrometry (PSMS).</p>Fórmula:C10H20N4O4Pureza:Min. 95%Peso molecular:260.29 g/mol(β-Asp5)-δ-Sleep Inducing Peptide trifluoroacetate salt
CAS:<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>Fórmula:C35H48N10O15Pureza:Min. 95%Peso molecular:848.81 g/mol(D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Leu6)-LHRH (1-8) (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C52H72N14O12Pureza:Min. 95%Peso molecular:1,085.22 g/molω-Agatoxin IVa trifluoroacetate
CAS:<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>Fórmula:C217H360N68O60S10Pureza:Min. 95%Peso molecular:5,202.26 g/mol2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride
CAS:<p>2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is a benzimidazole derivative. It has a chemical stability and can be used for wastewater treatment. It is also a pump inhibitor and can be used for anhydrous sodium magnesium salts. This product is synthesized from the reaction of protonated 2-bromo-4-methoxyphenol with 2,6-dimethylpyridine in the presence of hydrochloric acid. The reaction was carried out in an asymmetric synthesis using a proton transport system. 2-(Chloromethyl)-4-methoxy-3,5-dimethylpyridine hydrochloride is soluble in water and has a pH of 1 to 3. It has been shown that this product can be used as an antioxidant and as a metal chelation agent.</p>Fórmula:C9H13Cl2NOPureza:Min. 95%Forma y color:PowderPeso molecular:222.11 g/molAmyloid β/A4 Protein Precursor770 (740-770) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C162H243N45O52S2Pureza:Min. 95%Peso molecular:3,717.07 g/molPAR-2 (6-1) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C28H54N8O7Pureza:Min. 95%Peso molecular:614.78 g/molBiotinyl-Amylin (mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-Amylin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C177H286N54O55S3Pureza:Min. 95%Peso molecular:4,146.69 g/mol
