Compuestos y reactivos bioquímicos

A synthetic peptide for use as a blocking control in assays to test for specificity of OMP antibody, catalog no. 70R-2611

The SERCA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the nuclear protein SERCA2, which is involved in the regulation of calcium ion transport. This antibody is commonly used to study the role of SERCA2 in various biological processes such as glucose-6-phosphate metabolism and tyrosine phosphorylation. Additionally, it has been utilized in the detection and quantification of autoantibodies, including antiphospholipid antibodies, which are associated with autoimmune disorders. The SERCA2 antibody can also be used as an anti-connexin agent to block gap junction communication and investigate its impact on cellular signaling pathways. Furthermore, this antibody has potential applications as an anticoagulant due to its ability to inhibit collagen-induced platelet aggregation. With its high specificity and versatility, the SERCA2 antibody is a valuable tool for researchers in multiple fields of study.

A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf96 antibody, catalog no. 70R-3327

A synthetic peptide for use as a blocking control in assays to test for specificity of CES2 antibody, catalog no. 70R-3529

A synthetic peptide for use as a blocking control in assays to test for specificity of Pfkfb2 antibody, catalog no. 70R-9420

C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.
High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.
;

SEPP1 antibody was raised using the N terminal of SEPP1 corresponding to a region with amino acids LGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVAL

Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

The AKR1B1 antibody is a glycoprotein that targets a specific human protein. It is widely used in the field of Life Sciences for its antiviral properties. This antibody is commonly used in immunoassays, where it plays a crucial role in detecting and quantifying the presence of the target protein. The AKR1B1 antibody can also be used as a tool in various research applications, such as studying fatty acid metabolism or investigating the role of progesterone in cellular processes. It is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. The AKR1B1 antibody has been extensively tested and validated, ensuring reliable and accurate results in experiments. Whether you are conducting basic research or developing diagnostic assays, this antibody is an essential tool for your scientific endeavors.

Rabbit polyclonal EDG2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM113A antibody, catalog no. 70R-4107

Rabbit polyclonal HOXA7 antibody

Affinity purified Rabbit polyclonal PSMC6 antibody

Mouse thymocyte antibody was raised in rabbit using RBC-free murine thymocytes as the immunogen.

Please enquire for more information about Human Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Repotrectinib is an inhibitor of the enzyme c-Met, which is a receptor tyrosine kinase that is involved in various cellular processes. It has been shown to have potent antitumor activity against many solid tumor cell lines and murine xenografts. Repotrectinib inhibits cancer cells by binding to the c-Met receptor and preventing it from initiating downstream signaling pathways. The drug also has a low expression in normal tissues, which limits its toxicity. Repotrectinib's mechanism of action is through inhibition of the protein secretase, which prevents the conversion of pro-caspase-1 into active caspase-1. Caspase-1 has been shown to be essential for apoptosis induction in cancer cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of CHST6 antibody, catalog no. 70R-5372

Factor X antibody (HRP) was raised in goat using human Factor X purified from plasma as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDH12 antibody, catalog no. 70R-6110