CymitQuimica logo
Compuestos y reactivos bioquímicos

Compuestos y reactivos bioquímicos

Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.

Subcategorías de "Compuestos y reactivos bioquímicos"

Se han encontrado 130493 productos de "Compuestos y reactivos bioquímicos"

Ordenar por

Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
productos por página.
  • FLCN Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of FLCN antibody, catalog no. 70R-10331

    Pureza:Min. 95%

    Ref: 3D-33R-10310

    100µg
    Descatalogado
    Producto descatalogado
  • Canine IgG protein


    Canine IgG protein is a high-quality monoclonal antibody that is widely used in Life Sciences research. It is purified immunoglobulins that target specific antigens and are commonly used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. Canine IgG protein has been shown to inhibit microvessel density by blocking the activity of growth factors involved in angiogenesis. Additionally, this monoclonal antibody can be used to detect autoantibodies and monitor immune responses in experimental studies. The Canine IgG protein is supplied in a buffered solution that ensures stability and long shelf life. Its high affinity for nuclear β-catenin allows for accurate detection and quantification of this important marker. This product is manufactured using advanced techniques to ensure purity and consistency, making it an ideal choice for researchers looking for reliable results in their experiments.
    Pureza:Min. 95%

    Ref: 3D-31R-1065

    10mg
    Descatalogado
    Producto descatalogado
  • ANTP antibody


    ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

    Ref: 3D-70R-2190

    100µl
    Descatalogado
    Producto descatalogado
  • UBE3A Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of UBE3A antibody, catalog no. 70R-5237

    Pureza:Min. 95%

    Ref: 3D-33R-8617

    100µg
    Descatalogado
    Producto descatalogado
  • IGFBP1 antibody


    The IGFBP1 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes insulin-like growth factor binding protein 1 (IGFBP1). IGFBP1 is a key regulator of neurotrophic factors, such as TGF-β1, and plays a crucial role in various biological processes. By blocking the activity of IGFBP1, this antibody can modulate important cellular functions including natriuretic signaling, collagen synthesis, chemokine production, protein kinase activation, and nuclear events. Whether you are conducting research or developing therapeutics, the IGFBP1 antibody is an invaluable asset that can help unravel the complex mechanisms underlying various diseases and pave the way for novel treatments.

    Ref: 3D-70R-14019

    100µg
    Descatalogado
    Producto descatalogado
  • Arntl2 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of Arntl2 antibody, catalog no. 70R-8344
    Pureza:Min. 95%

    Ref: 3D-33R-7145

    100µg
    Descatalogado
    Producto descatalogado
  • C1ORF166 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf166 antibody, catalog no. 70R-5998

    Pureza:Min. 95%

    Ref: 3D-33R-3439

    100µg
    Descatalogado
    Producto descatalogado
  • Triosephosphate isomerase antibody


    Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.

    Ref: 3D-70R-12818

    100µl
    Descatalogado
    Producto descatalogado
  • GSTA1 antibody


    Affinity purified Rabbit polyclonal GSTA1 antibody

    Ref: 3D-70R-13136

    100µl
    Descatalogado
    Producto descatalogado
  • Annexin A2 antibody


    The Annexin A2 antibody is a highly specific monoclonal antibody that targets the Annexin A2 protein. This antibody is commonly used in Life Sciences research and diagnostics. Annexin A2 is an acidic protein that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. It has been shown to interact with epidermal growth factor (EGF) and act as a co-receptor for EGF receptor signaling.

    Ref: 3D-70R-13890

    100µg
    Descatalogado
    Producto descatalogado
  • BCAR1 antibody


    BCAR1 antibody was raised in Rabbit using Human BCAR1 as the immunogen

    Ref: 3D-70R-15968

    50µl
    Descatalogado
    Producto descatalogado
  • SLC25A32 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A32 antibody, catalog no. 70R-6474

    Pureza:Min. 95%

    Ref: 3D-33R-6857

    100µg
    Descatalogado
    Producto descatalogado
  • USP36 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of USP36 antibody, catalog no. 70R-3767

    Pureza:Min. 95%

    Ref: 3D-33R-8754

    100µg
    Descatalogado
    Producto descatalogado
  • RASSF1 antibody


    Mouse monoclonal RASSF1 antibody

    Ref: 3D-10R-7134

    100µl
    Descatalogado
    Producto descatalogado
  • Sheep IgG (FITC)


    Purified Sheep IgG FITC conjugate
    Pureza:Min. 95%

    Ref: 3D-65R-1002

    100µg
    Descatalogado
    Producto descatalogado
  • COL8A1 antibody


    COL8A1 antibody was raised in Rabbit using Human COL8A1 as the immunogen

    Ref: 3D-70R-16505

    50µl
    Descatalogado
    Producto descatalogado
  • SEPP1 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of SEPP1 antibody, catalog no. 70R-2714

    Pureza:Min. 95%

    Ref: 3D-33R-4984

    100µg
    Descatalogado
    Producto descatalogado
  • ACPT Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of ACPT antibody, catalog no. 70R-7296

    Pureza:Min. 95%

    Ref: 3D-33R-9175

    100µg
    Descatalogado
    Producto descatalogado
  • AmpliStain anti Mouse 1 Step (HRP)


    Mouse antigen staining reagent for use in IHC
    Pureza:Min. 95%

    Ref: 3D-75R-1061

    6ml
    Descatalogado
    Producto descatalogado
  • BC37295_3 Blocking Peptide


    A synthetic peptide for use as a blocking control in assays to test for specificity of BC37295_3 antibody, catalog no. 70R-8171

    Pureza:Min. 95%

    Ref: 3D-33R-10257

    100µg
    Descatalogado
    Producto descatalogado