Compuestos y reactivos bioquímicos
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(98.574 productos)
- Por objetivo biológico(100.726 productos)
- Según efectos farmacológicos(6.937 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(439 productos)
- Biología Vegetal(6.907 productos)
- Metabolitos secundarios(14.367 productos)
Se han encontrado 130493 productos de "Compuestos y reactivos bioquímicos"
FLCN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLCN antibody, catalog no. 70R-10331
Pureza:Min. 95%Canine IgG protein
Canine IgG protein is a high-quality monoclonal antibody that is widely used in Life Sciences research. It is purified immunoglobulins that target specific antigens and are commonly used for various applications, including immunohistochemistry, Western blotting, and ELISA assays. Canine IgG protein has been shown to inhibit microvessel density by blocking the activity of growth factors involved in angiogenesis. Additionally, this monoclonal antibody can be used to detect autoantibodies and monitor immune responses in experimental studies. The Canine IgG protein is supplied in a buffered solution that ensures stability and long shelf life. Its high affinity for nuclear β-catenin allows for accurate detection and quantification of this important marker. This product is manufactured using advanced techniques to ensure purity and consistency, making it an ideal choice for researchers looking for reliable results in their experiments.Pureza:Min. 95%ANTP antibody
ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
UBE3A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE3A antibody, catalog no. 70R-5237
Pureza:Min. 95%IGFBP1 antibody
The IGFBP1 antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes insulin-like growth factor binding protein 1 (IGFBP1). IGFBP1 is a key regulator of neurotrophic factors, such as TGF-β1, and plays a crucial role in various biological processes. By blocking the activity of IGFBP1, this antibody can modulate important cellular functions including natriuretic signaling, collagen synthesis, chemokine production, protein kinase activation, and nuclear events. Whether you are conducting research or developing therapeutics, the IGFBP1 antibody is an invaluable asset that can help unravel the complex mechanisms underlying various diseases and pave the way for novel treatments.
Arntl2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Arntl2 antibody, catalog no. 70R-8344Pureza:Min. 95%C1ORF166 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf166 antibody, catalog no. 70R-5998
Pureza:Min. 95%Triosephosphate isomerase antibody
Triosephosphate isomerase antibody is an antigen-specific antibody that specifically targets triosephosphate isomerase, a key enzyme involved in glycolysis. It is available as both polyclonal and monoclonal antibodies. These antibodies are widely used in life sciences research for various applications, including Western blotting, immunohistochemistry, and ELISA assays. Triosephosphate isomerase antibody can be used to study the expression and localization of triosephosphate isomerase in different tissues and cell types. It can also be used to investigate the role of triosephosphate isomerase in metabolic pathways and its potential as a therapeutic target. This antibody has been validated for its specificity and sensitivity, ensuring accurate and reliable results in experimental studies. Whether you are studying cellular processes, protein-protein interactions, or disease mechanisms, triosephosphate isomerase antibody will be a valuable tool in your research endeavors.
Annexin A2 antibody
The Annexin A2 antibody is a highly specific monoclonal antibody that targets the Annexin A2 protein. This antibody is commonly used in Life Sciences research and diagnostics. Annexin A2 is an acidic protein that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. It has been shown to interact with epidermal growth factor (EGF) and act as a co-receptor for EGF receptor signaling.
SLC25A32 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A32 antibody, catalog no. 70R-6474
Pureza:Min. 95%USP36 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of USP36 antibody, catalog no. 70R-3767
Pureza:Min. 95%SEPP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SEPP1 antibody, catalog no. 70R-2714
Pureza:Min. 95%ACPT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACPT antibody, catalog no. 70R-7296
Pureza:Min. 95%BC37295_3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BC37295_3 antibody, catalog no. 70R-8171
Pureza:Min. 95%
