Compuestos y reactivos bioquímicos
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(98.678 productos)
- Por objetivo biológico(100.149 productos)
- Según efectos farmacológicos(6.845 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(356 productos)
- Biología Vegetal(6.910 productos)
- Metabolitos secundarios(14.344 productos)
Se han encontrado 130210 productos de "Compuestos y reactivos bioquímicos"
Biotin-Bradykinin
Catalogue peptide; min. 95% purity
Fórmula:C60H87N17O13SPeso molecular:1,286.53 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Fórmula:C18H33N5O4Peso molecular:383.49 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C23H33N5O9Peso molecular:523.55 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Fórmula:C116H161N27O32S4Peso molecular:2,573.99 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Atorvastatin sodium
CAS:HMG-CoA reductase antagonist
Fórmula:C33H35FN2O5•NaPureza:Min. 95%Forma y color:PowderPeso molecular:581.63 g/molPergolide mesylate
CAS:Producto controladoD1 and D2 dopamine agonist
Fórmula:C20H30N2O3S2Pureza:Min. 95%Forma y color:White To Off-White SolidPeso molecular:410.6 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111733
Producto descatalogadoKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Fórmula:C34H50N8O6SPeso molecular:698.9 g/mol[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Fórmula:C67H118N26O17Peso molecular:1,559.85 g/molSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C32H48N8O14Peso molecular:768.78 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C36H39F3N6O13SPureza:Min. 95%Peso molecular:852.79 g/molRef: 3D-FA110597
Producto descatalogadoNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Fórmula:C53H84N12O16Peso molecular:1,145.33 g/molLanabecestat
CAS:Lanabecestat is an investigational drug, classified as a beta-secretase (BACE) inhibitor, which is derived from synthetic chemical processes. Its mode of action involves inhibiting the enzyme beta-secretase, which plays a crucial role in the amyloidogenic pathway by cleaving amyloid precursor protein (APP) into amyloid-beta peptides. The accumulation of these peptides is a hallmark of Alzheimer's disease pathology.
Fórmula:C26H28N4OPureza:Min. 95%Forma y color:PowderPeso molecular:412.53 g/molRef: 3D-IFC98264
Producto descatalogadoICG 001
CAS:Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin
Fórmula:C33H32N4O4Pureza:Min. 95%Peso molecular:548.63 g/molKUNB31
CAS:KUNB31 is a synthetic enzyme inhibitor, which is an engineered compound designed to interfere with the activity of specific enzymes in various biochemical pathways. This product is synthesized through a series of complex chemical reactions, ensuring high specificity and activity against target enzymes. Its mode of action involves binding to the active sites of enzymes, thereby preventing substrates from interacting and altering enzymatic activity.
Fórmula:C19H18N2O3Pureza:Min. 95%Peso molecular:322.4 g/molRef: 3D-VND26380
Producto descatalogadogp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Fórmula:C135H221N45O33Peso molecular:3,002.55 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Fórmula:C145H210N42O45Peso molecular:3,261.54 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Fórmula:C45H82N14O13SPeso molecular:1,059.31 g/molSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Fórmula:C63H98N18O13SPeso molecular:1,347.66 g/mol
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
