Compuestos y reactivos bioquímicos
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(98.766 productos)
- Por objetivo biológico(100.282 productos)
- Según efectos farmacológicos(6.822 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(355 productos)
- Biología Vegetal(6.882 productos)
- Metabolitos secundarios(14.351 productos)
Se han encontrado 130641 productos de "Compuestos y reactivos bioquímicos"
Parietal Cell ELISA kit
ELISA kit for the detection of Parietal Cell in the research laboratory
Pureza:Min. 95%SOX2 antibody
The SOX2 antibody is a highly specific and reliable tool used in immunohistochemistry and other life science research applications. This monoclonal antibody binds to the SOX2 antigen, which is a nuclear DNA-binding protein involved in the regulation of embryonic development and cell differentiation. The SOX2 antibody has been extensively validated for its performance in various experimental techniques, including electrochemical impedance spectroscopy.
C10ORF83 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf83 antibody, catalog no. 70R-3297
Pureza:Min. 95%BIRC5 antibody
The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.
Atp11c antibody
Atp11c antibody was raised in rabbit using the C terminal of Atp11c as the immunogenPureza:Min. 95%FOXN4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FOXN4 antibody, catalog no. 70R-8770
Pureza:Min. 95%C11ORF65 antibody
C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI
BTN3A2 antibody
The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.
Mouse Vasopressin ELISA kit
ELISA Kit for detection of Vasopressin in the research laboratory
Pureza:Min. 95%ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Pureza:Min. 95%DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
