Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.197 productos)
- Por objetivo biológico(100.313 productos)
- Según efectos farmacológicos(6.790 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.835 productos)
- Metabolitos secundarios(14.348 productos)
Se han encontrado 130603 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Dok-4 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H101N21O18Peso molecular:1,524.72 g/molProsaptide 769P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H194N28O35SPeso molecular:2,548.98 g/mol4A/4B, 5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H73N11O22S3Peso molecular:1,264.38 g/molSalusin-α
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H192N40O30Peso molecular:2,602.99 g/molbeta-Amyloid (18-28)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H81N13O18Peso molecular:1,212.34 g/molSomatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molSomatostatin-14 (3-10)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H72N12O11SPeso molecular:1,073.28 g/molMSH Release Inhibiting Factor, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C13H24N4O3Peso molecular:284.36 g/molCorticostatin, rabbit
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C163H265N63O44S6Peso molecular:4,003.66 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H89N17O14Peso molecular:1,260.47 g/molNeuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C182H282N54O52S4Peso molecular:4,186.86 g/molα-CGRP (33-37) (canine, mouse, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C22H32N6O8Peso molecular:508.54 g/molForkhead derived peptide, Woodtide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H123N21O20SPeso molecular:1,586.93 g/mol[Arg8]-Vasotocin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H67N15O12S2Peso molecular:1,050.23 g/mol[D-Tyr11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H121N21O20Peso molecular:1,673 g/mol[Pyr6]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H49N7O7SPeso molecular:723.91 g/molbFGF Inhibitory Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H53N11O11Peso molecular:815.89 g/molC. difficile Toxin B (8-16)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H81N15O14SPeso molecular:1,088.30 g/molTetanus toxin (TT) peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H120N18O21Peso molecular:1,657.95 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H67N13O9Peso molecular:922.11 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C71H96N16O17S2Peso molecular:1,509.78 g/molbeta-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H102N16O21SPeso molecular:1,403.63 g/molPonatinib HCl
CAS:<p>BCR-ABL1 tyrosine kinase inhibitor</p>Fórmula:C29H27F3N6O·HClPureza:Min. 95%Peso molecular:569.02 g/molAquaporin-2 (254-267), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H116N24O22Peso molecular:1,633.84 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C15H28N4O5Peso molecular:344.41 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H85N15O18Peso molecular:1,172.31 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H109N23O23Peso molecular:1,592.74 g/molAc-ACTH (1-14), 10-1-12A
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H111N21O21SPeso molecular:1,722.96 g/molDoc-6 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H134N26O26SPeso molecular:1,980.25 g/mol[Val35] -beta-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C203H311N55O60Peso molecular:4,481.96 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C219H365N73O66SPeso molecular:5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H108N22O16Peso molecular:1,453.72 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Peso molecular:1,745.99 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H97N21O16S1Peso molecular:1,424.66 g/molTransforming Growth Factor beta1 Peptide, TGF-beta1 (60-66), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H78N12O10Peso molecular:947.20 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H43N7O6SPeso molecular:701.85 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C197H317N59O54S3Peso molecular:4,472.26 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H91N17O15Peso molecular:1,254.47 g/molIL-1b (208-240) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C191H292N48O51SPeso molecular:4,108.81 g/molAGRP (54-82)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C137H225N39O54Peso molecular:3,282.47 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H123N27O27S5Peso molecular:2,091.39 g/molbeta-Casein (90-96)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C143H226N46O39Peso molecular:3,213.6 g/molPre-S1 (12-32)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H86N13O22PPeso molecular:1,300.36 g/molSMCX (963-973) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H81N13O18Peso molecular:1,128.26 g/molRS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H85N25O15Peso molecular:1,204.33 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H91N21O14Peso molecular:1,246.45 g/mol[Ser25]-PKC (19-36) Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C93H159N35O25Peso molecular:2,167.52 g/molAmyloid Dan Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C185H270N48O51S2Peso molecular:4,046.63 g/molHIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C116H164N32O31SPeso molecular:2,534.86 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C108H159N23O39S2Peso molecular:2,467.72 g/molBiotin-Amyloid beta-Protein (1-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C213H325N57O62S2Peso molecular:4,740.44 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molα-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H87N15O9SPeso molecular:1,206.53 g/molHC-067047
CAS:<p>HC-067047 is an experimental drug that has been shown to decrease the intracellular Ca2+ concentration in various cell types, including neurons. This agent also inhibits the influx of Ca2+ ions through voltage-gated channels and blocks the release of Ca2+ from intracellular stores. HC-067047 is being investigated for chronic cough as it has been shown to reduce this symptom in a guinea pig model of asthma. In vitro studies have shown that HC-067047 is not active against protozoa or bacteria but does inhibit the growth of tumor cells. The mechanism of action for HC-067047 is not fully elucidated, but it may act by inhibiting ion transport proteins such as TRPV4, Toll-like receptor, or Ryanodine receptor. HC-067047 has also been found to increase MMP9 activity and inhibit production of cytokines such as IL-6 and TNFα.</p>Fórmula:C26H28F3N3O2Pureza:Min. 95%Peso molecular:471.51 g/molHerpes Virus Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H64N10O14Peso molecular:920.46 g/molBiotin-Neuromedin B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H87N17O14S2Peso molecular:1,358.62 g/mol[Cys0]-GTP-Binding Protein Gsa (28-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C85H143N30O24SPeso molecular:2,001.29 g/molFMRF amide Molluscan Cardioexcitatory Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C29H42N8O4SPeso molecular:598.76 g/molEGF Receptor (988-993) (phosphorylated) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H46N7O16PPeso molecular:804.7 g/molCecropin P1 (porcine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H253N46O43Peso molecular:3,338.93 g/molbeta-Interleukin II (44-56)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H113N19O19Peso molecular:1,500.77 g/molGalanin (1-13)-Spantide I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C138H199N35O30Peso molecular:2,828.34 g/molSaposin C22
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C116H196N28O37SPeso molecular:2,607.02 g/molFibronectin Analog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C29H51N11O11Peso molecular:729.80 g/molBTK derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/molOV-2, Sheep
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C84H159N29O14Peso molecular:1,799.39 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C171H271N51O54S2Peso molecular:3,969.50 g/molACTH (12-39), rat
Catalogue peptide; min. 95% purityFórmula:C145H227N39O41Peso molecular:3,172.66 g/mol1,2-Dilauroyl-rac-glycero-3-phosphocholine
CAS:<p>1,2-Dilauroyl-rac-glycero-3-phosphocholine (DLPC) is a synthetic phospholipid that exhibits significant cytotoxicity against hyperproliferative cells. DLPC has been shown to inhibit the activity of the enzyme sphingosine 2-phosphate (S2P) and cell factor, both of which are important in signal transduction pathways. DLPC is capable of inducing phase transition at a temperature close to body temperature, making it biocompatible for use as a topical or injectable drug. It has also been shown to be effective in treating infectious diseases such as HIV and malaria, due to its ability to bind with basic proteins found on the surface of these viruses.</p>Fórmula:C32H64NO8PPureza:Min. 95%Peso molecular:621.83 g/molBpoc-Gly-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Bpoc-Gly-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H19NO4·C12H23NPureza:Min. 95%Peso molecular:494.67 g/molFITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I)
CAS:<p>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) is a bioactive molecule that has been shown to inhibit the growth of filamentous fungi. This compound binds to the tyrosine kinase, which is an enzyme involved in the regulation of cell division and differentiation. It also inhibits neutrophil recruitment by dectin-1, a protein that recognizes fungal cell walls on neutrophils. The FITC isomer I has been shown to impair macrophages and fungus aspergillus fumigatus infiltration in tissues with impaired immune function.<br>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) has also been shown to decrease the production of caspase 1, which activates inflammatory responses and stimulates phagocytic cells.</p>Fórmula:C42H39N5O12SPureza:Min. 95%Peso molecular:837.85 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS:<p>L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.</p>Fórmula:C30H62N10O6Pureza:Min. 95%Peso molecular:658.88 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H43FN4O14Pureza:Min. 95%Peso molecular:834.8 g/molFITC-beta-Ala-Amyloid beta-Protein (1-40)
CAS:<p>Please enquire for more information about FITC-beta-Ala-Amyloid beta-Protein (1-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C218H311N55O64S2Pureza:Min. 95%Peso molecular:4,790.27 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H35N5O5·HClPureza:Min. 95%Peso molecular:534.05 g/molNeostigmine methyl sulfate
CAS:<p>Inhibitor of acetylcholinesterase</p>Fórmula:C13H22N2O6SPureza:Min. 95%Forma y color:PowderPeso molecular:334.39 g/molH-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H47FN6O14Pureza:Min. 95%Peso molecular:914.89 g/molH-Glu-Ala-OH
CAS:<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br><br>br>br><br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>Fórmula:C8H14N2O5Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:218.21 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H84N18O14Pureza:Min. 95%Peso molecular:1,269.41 g/mol(±)-Carazolol-d7
CAS:<p>(±)-Carazolol-d7 is a deuterated beta-adrenergic receptor antagonist, often used for pharmacological and biochemical studies. This isotopically labeled compound is a synthetic derivative of carazolol, sourced through precise deuterium exchange techniques designed to ensure high isotopic purity.</p>Fórmula:C18H22N2O2Pureza:Min. 95%Peso molecular:305.4 g/molAc-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt
CAS:Please enquire for more information about Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C31H53N5O8SPureza:Min. 95%Peso molecular:655.85 g/molGSK 2193874
CAS:<p>GSK2193874 is a potent and selective small molecule for the treatment of chronic cough. It inhibits the activation of TRPV4, which is a member of the transient receptor potential cation channel family, in primary cells by pharmacological agents and in vitro by intracellular Ca2+ levels. GSK2193874 has been shown to inhibit acetylcholinesterase activity and to increase cytosolic calcium levels in atrial myocytes. This drug also has effects on congestive heart failure (CHF) patients, such as an increase in left ventricular function and improved pulmonary hemodynamics. GSK2193874 also binds to toll-like receptor 4 (TLR4), which may be a therapeutic target for the treatment of chronic cough.</p>Fórmula:C37H38BrF3N4OPureza:Min. 95%Peso molecular:691.62 g/molH-D-Arg-Arg-Pro-Hyp-Gly-beta-(2-thienyl)-Ala-Ser-D-Phe-b-(2-thienyl)-Ala-Arg-OH
CAS:<p>Enalaprilat is a prodrug that is converted to the active drug enalapril in vivo. It is a potent angiotensin-converting enzyme (ACE) inhibitor that prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilatation and reduced blood pressure. Enalaprilat has been shown to be effective in lowering blood pressure in patients with cardiac insufficiency or hypertension. It also has been shown to decrease the production of endogenous bradykinin, which acts on its receptor B2, leading to vasodilatation and reduced blood pressure. The most common side effect of enalaprilat therapy is cutaneous reactions such as erythema, rash, or pruritus.</p>Fórmula:C56H83N19O13S2Pureza:Min. 95%Peso molecular:1,294.51 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H47FN4O15Pureza:Min. 95%Peso molecular:878.85 g/molAbz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H62N12O15SPureza:Min. 95%Peso molecular:1,019.09 g/molH-Ser-Glu-OH
CAS:<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>Fórmula:C8H14N2O6Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:234.21 g/molPeptide Lv (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide Lv (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C262H415N73O72S2Pureza:Min. 95%Peso molecular:5,803.68 g/mol4-Alkoxybenzyl alcohol resin (100-200 mesh)
CAS:<p>4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.</p>Forma y color:PowderAc-D-Lys-OH
CAS:<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>Fórmula:C8H16N2O3Pureza:Min. 95%Peso molecular:188.22 g/mol
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Arg8]-Vasotocin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00302.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Val35] -beta-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00606.webp&w=3840&q=75)
![[Cys0]-GTP-Binding Protein Gsa (28-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00280.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFA110006.webp&w=3840&q=75)
