Compuestos y reactivos bioquímicos

<p>Ferritin antibody was raised in rabbit using human liver ferritin as the immunogen.</p>

<p>TSH antibody was raised in mouse using TSH from the human pituitary as the immunogen.</p>

<p>Oxyphenbutazone antibody was raised in rabbit using oxyphenbutazone-KLH as the immunogen.</p>

<p>cAMP antibody was raised in rabbit using succinyl-cAMP-BSA as the immunogen.</p>

<p>HIV1-RT antibody was raised in mouse using full length recombinant RT (HIV-1, IIIB) as the immunogen.</p>

<p>Thyroxine antibody was raised in sheep using T4-BSA as the immunogen.</p>

<p>Elastase antibody was raised in rabbit using elastase as the immunogen.</p>

<p>Luteinizing hormone antibody was raised in goat using human LH as the immunogen.</p>

<p>Streptococcus group A antibody was raised in goat using group A Streptococci as the immunogen.</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>HIV1 p24 antibody is a monoclonal antibody that specifically targets the p24 protein of the human immunodeficiency virus (HIV-1). This antibody has been widely used in research and diagnostic applications in the field of life sciences. It can be used for various purposes, such as detecting the presence of HIV-1 infection, studying viral replication and pathogenesis, and developing new therapeutic approaches. The HIV1 p24 antibody exhibits high specificity and sensitivity, making it a valuable tool for researchers and healthcare professionals working in the field of HIV/AIDS. Additionally, this antibody has cytotoxic properties that can be utilized for targeted therapy against HIV-infected cells. Its unique ability to bind to the p24 protein with high affinity makes it an essential component in the development of diagnostic tests and potential treatments for HIV/AIDS.</p>

<p>The HIV1 Nef protein is a crucial component in the study of Life Sciences and has various applications in research and diagnostics. It is an antigen binding molecule that can be used in immunoassays and as a tool for studying receptor binding. The HIV1 Nef protein can be detected using colloidal or monoclonal antibodies, which specifically bind to this protein. These binding proteins are highly specific and can be used to detect the presence of the HIV1 Nef protein in samples.</p>

<p>HIV1 rev antibody was raised in mouse using full length recombinant rev (HIV-1) produced in E.coli expression system as the immunogen.</p>

<p>SOD antibody was raised in sheep using human SOD purified from the liver liver as the immunogen.</p>

<p>FBP antibody was raised in rabbit using bovine milk as the immunogen.</p>

<p>Morphine 6 antibody was raised in goat using 6-carboxymethyl-morphine-BSA as the immunogen.</p>

<p>Filamentous Hemagglutinin purified from Bordetella Pertussis</p>

<p>Human IgE antibody was raised in goat using human IgE as the immunogen.</p>

<p>Purified recombinant HTLV1 gp46 protein</p>

<p>Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chymotrypsin antibody was raised in rabbit using pancreatic chymotrypsin as the immunogen.</p>

<p>PTH antibody was raised in goat using glandular PTH as the immunogen.</p>

<p>Dilantin antibody was raised in goat using phenytoin-BSA as the immunogen.</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>

<p>PTH antibody was raised in goat using PTH as the immunogen.</p>

<p>Purified recombinant HIV1 p17 protein</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>Cortisol Saliva ELISA Kit</p>

<p>Rabbit Polyclonal HIV1 protease antibody; 1mg/ml; Supplied in frozen form.</p>

<p>CEA antibody was raised in goat using human CEA as the immunogen.</p>

<p>hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.</p>

<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>

<p>Purified recombinant HIV1 tat HxB2 (HRP)</p>

<p>Cianopramine is a potent, selective inhibitor of the uptake of 5-hydroxytryptamine (5-HT) at 5-HT2 receptors. It has been shown to be effective in vivo models for chronic schizophrenia and has shown promising results in clinical trials with drug-naive patients. Cianopramine also inhibits the binding of drugs such as clomipramine and other tricyclic antidepressants to their receptor sites. In addition, cianopramine is a bicyclic heterocycle that binds to the human serum albumin with high affinity and specificity.</p>

<p>Serotonin ELISA Kit for the rapid quantitative determination of Serotonin in serum, urine and platelets</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>ApoB antibody was raised in goat using human apolipoprotein B as the immunogen.</p>

<p>Microtubule-stabilizing agent; antineoplastic;</p>

<p>Goat anti Human IgE antibody</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola.</p>

<p>Goat polyclonal Human ApoB antibody</p>

<p>Progesterone 3 antibody was raised in rabbit using progesterone 3-CMO-BSA as the immunogen.</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>The Measles Virus Nucleoprotein antibody is a monoclonal antibody that specifically targets the α-syn protein. It is widely used in life sciences research, particularly in studies related to polymerase chain reactions and cytotoxicity assays. This antibody has been shown to have high affinity and specificity for the α-syn protein, making it an ideal tool for detecting and quantifying this protein in various biological samples.</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>Vitamin B12 antibody was raised in rabbit using Vitamin B12-BSA as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (HRP)</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal Human CRP antibody</p>

<p>FABP antibody was raised in goat using purifed FABP from human heart tissue as the immunogen.</p>

<p>Purified recombinant HIV2 gp105 protein</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>Complement C3 antibody was raised in goat using human C3 complement as the immunogen.</p>

<p>The CMV antibody is a monoclonal antibody that targets the endothelial growth factor in the body. It is used in life sciences research to study the role of this growth factor in various biological processes. The CMV antibody specifically binds to the nuclear component of the endothelial growth factor and blocks its activity. This antibody has been widely used in studies related to insulin resistance, autoantibodies, and anti-HER2 therapy. Additionally, it has shown potential as a therapeutic agent for inhibiting tumor growth by targeting the epidermal growth factor pathway. The CMV antibody is a valuable tool for researchers studying the mechanisms of cell proliferation and differentiation in different tissues and diseases.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>Rabbit polyclonal HIV1 IIIB protease antibody (FITC)</p>

<p>Nortestosterone antibody was raised in rabbit using 19-nortestosterone-17-KLH as the immunogen.</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>Human monoclonal antibody targeting activin receptor type-2B; treatment of muscle loss and weakness</p>

<p>AFP antibody was raised in goat using human AFP from cord serum as the immunogen.</p>

<p>Purified recombinant HIV1 p24 protein (HRP)</p>

<p>Purified recombinant HIV1 p24 HxB2 (HRP)</p>

<p>HSV1 + HSV2 ICP35 antibody was raised in mouse using herpes simplex virus ICP35 as the immunogen.</p>

<p>Purified recombinant HIV1-RT protein</p>

<p>ELISA kit for the detection of Cardiolipin IgG/IgM1 in the research laboratory</p>

<p>HIV2 p26 antibody was raised in mouse using purified, full length recombinant p26 (HIV-2 ROD) produced in E. coli expression system as the immunogen.</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Goat polyclonal Human Properdin antibody</p>

<p>Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)</p>

<p>SK channel blocker</p>

<p>NSE antibody was raised in mouse using NSE from the human brain as the immunogen.</p>

<p>C-myc antibody was raised in chicken using residues 410-419 (EQKLISEEDL) of human myc conjugated to KLH as the immunogen.</p>

<p>Purified recombinant TPO protein (His tag)</p>

<p>Mouse monoclonal HSV2 gD antibody</p>

<p>Mouse monoclonal HIV2 gp105 antibody (biotin)</p>

<p>Human IgE antibody was raised in goat using human myeloma IgE as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Goat polyclonal HIV2 gp105 antibody</p>

<p>Sirt7 inhibitor 97491 is an anticancer drug that works by inhibiting the activity of Sirt7, a protein that promotes tumor growth. This inhibitor has been shown to be effective in human cancer cell lines and may have potential for use in cancer therapy. The drug has been tested in Chinese hamster ovary cells and was found to induce apoptosis, or programmed cell death, in these cells. Sirt7 inhibitor 97491 is an analog of chloroquine and can also inhibit kinases, which are enzymes involved in signaling pathways that regulate cell growth and division. In addition, this inhibitor has been found to increase the effectiveness of other anticancer drugs such as artesunate. Overall, Sirt7 inhibitor 97491 is a promising new drug candidate for the treatment of cancer.</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>ELISA kit for the detection of dsDNA IgG in the research laboratory</p>

<p>CRP Goat Polyclonal Antibody, IgG Fraction is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CRP Goat Polyclonal Antibody, IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>hCG beta antibody was raised in rabbit using HCG beta-KLH as the immunogen.</p>

<p>Goat polyclonal Human AFP antibody</p>

<p>Please enquire for more information about Anti-Rubella IgM Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal CRP antibody</p>

<p>Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C type natriuretic peptide (CNP) and urodilatin.</p>

<p>Goat polyclonal Human Antithrombin III antibody</p>

<p>Goat polyclonal Human Cystatin C antibody</p>

<p>HIV1 p24 antibody was raised in rabbit using full length recombinant p24 expressed in baculovirus expression system as the immunogen.</p>

<p>HIV1 p24 antibody (FITC) was raised in goat using purified, full length recombinant p24 (HIV-1 IIIB) produced in baculovirus expression system as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Protected amino acid</p>