Compuestos y reactivos bioquímicos

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Estradiol 3+6 antibody was raised in rabbit using 17 beta-estradiol-6 and 3-BSA as the immunogen.</p>

<p>PTH antibody was raised in goat using human PTH human as the immunogen.</p>

<p>HIV1 p24 antibody was raised in goat using p24 (HIV-1 IIIB) as the immunogen.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Troponin I antibody</p>

<p>HIV1 tat antibody was raised in sheep using glutathione-S-transferase (GST) fusion protein (E. coli) as the immunogen.</p>

<p>HIV1 p24 antibody was raised in mouse using full length recombinant p24 (HIV-1) produced in baculovirus expression system as the immunogen.</p>

<p>Gentamicin antibody was raised in rabbit using gentamycin-KLH as the immunogen.</p>

<p>The CD4 protein is a glycoprotein that plays a crucial role in the immune system. It is primarily found on the surface of helper T cells, which are a type of white blood cell involved in coordinating immune responses. The CD4 protein acts as a receptor for the HIV virus, allowing it to enter and infect host cells.</p>

<p>Cianopramine is a potent, selective inhibitor of the uptake of 5-hydroxytryptamine (5-HT) at 5-HT2 receptors. It has been shown to be effective in vivo models for chronic schizophrenia and has shown promising results in clinical trials with drug-naive patients. Cianopramine also inhibits the binding of drugs such as clomipramine and other tricyclic antidepressants to their receptor sites. In addition, cianopramine is a bicyclic heterocycle that binds to the human serum albumin with high affinity and specificity.</p>

<p>BGH antibody was raised in rabbit using bovine growth hormone as the immunogen.</p>

<p>Epitestosterone antibody was raised in rabbit using protein-3-oxime-epitestosterone conjugate as the immunogen.</p>

<p>TSH antibody was raised in rabbit using human pituitary TSH affinity purified antigen as the immunogen.</p>

<p>Clonidine antibody was raised in rabbit using Clonidine-BSA as the immunogen.</p>

<p>Purified recombinant HIV1 tat HxB2 (HRP)</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 50 ug/vial; clone 4</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Conjugated Estradiol 3 CMO-HRP hapten</p>

<p>Rabbit polyclonal HIV-1 gp160 antibody</p>

<p>Serotonin ELISA Kit for the rapid quantitative determination of Serotonin in serum, urine and platelets</p>

<p>Purified recombinant HIV1 rev HxB2/HxB3 (FITC)</p>

<p>Purified recombinant HBsAg protein (Subtype adr)</p>

<p>PTH antibody was raised in rabbit using hPTH-44-68-TBG as the immunogen.</p>

<p>PTH antibody was raised in rabbit using human glandular PTH as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified recombinant HIV1-RT protein</p>

<p>HTLV-1 antibody (FITC) was raised in mouse using HTLV-1 (DIVmac251) as the immunogen.</p>

<p>SIV mac251 gp120 antibody was raised in rabbit using purified, full length recombinant gp120 (SIV-1mac251) produced in baculovirus expression system as the immunogen.</p>

<p>ApoB antibody was raised in mouse using human low density lipoprotein as the immunogen.</p>

<p>Mouse monoclonal HIV1 rev antibody (HRP)</p>

<p>The HIV1 tat antibody is a highly specialized monoclonal antibody that targets the HIV-1 Tat protein. This protein plays a crucial role in the replication and transmission of the virus. The HIV1 tat antibody has been extensively studied and has shown potent neutralizing activity against the Tat protein, inhibiting its function and preventing viral replication.</p>

<p>Mouse monoclonal T-cell receptor antibody (biotin); IgG1; 50 ug/vial; clone 4</p>

<p>Guinea pig polyclonal Goat Serum antibody</p>

<p>Rabbit anti Sheep IgG was raised in rabbit using affinity pure Sheep IgG as the immunogen.</p>

<p>Please enquire for more information about Alpha-Fetoprotein (AFP) Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified recombinant HIV2 gp36 ROD (HRP)</p>

<p>HPV6 antibody was raised in mouse using papilloma virus type 6 as the immunogen.</p>

<p>Sheep polyclonal HIV1 p24 antibody (biotin)</p>

<p>PTH antibody was raised in goat using PTH as the immunogen.</p>

<p>HIV1 tat antibody was raised in rabbit using purified, full length recombinant TAT (HIV-1) as the immunogen.</p>

<p>Please enquire for more information about Treponema Pallidum p15 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>The hCG beta antibody is a monoclonal antibody that specifically targets and neutralizes the human chorionic gonadotropin (hCG) beta subunit. This antibody is known to form dimers, which enhance its binding affinity and neutralizing activity against hCG. It has been widely used in life sciences research to study the role of hCG in various biological processes.</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC)</p>

<p>Donkey polyclonal anti Human Lambda Light Chain antibody</p>

<p>Goat polyclonal Cystatin C antibody</p>

<p>Prodrug of dihydroartemisin (DHA); antimalarial</p>

<p>Purified recombinant SIV mac251 gp28 (HRP)</p>

<p>Digoxin antibody was raised in goat using digoxin-BSA as the immunogen.</p>

<p>Goat polyclonal Human Transferrin antibody</p>

<p>Triiodothyronine antibody was raised in rabbit using T3-BSA as the immunogen.</p>

<p>HIV1 p24 antibody (IgG purified) was raised in sheep using purified full length recombinant p24 as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal HIV2 gp105 antibody (HRP)</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Goat polyclonal Human Complement C1r antibody</p>

<p>Goat anti Human Kappa light chain antibody</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>Testosterone 3 antibody was raised in rabbit using testosterone-3-oxime albumin as the immunogen.</p>

<p>hCG Beta antibody was raised in goat using hCG beta subunit as the immunogen.</p>

<p>Rabbit polyclonal HIV-2 antibody (biotin)</p>

<p>EPOr antibody was raised in sheep using Erythropoietin (EPO) receptor as the immunogen.</p>

<p>Rabbit polyclonal HIV2 Rev antibody</p>

<p>Purified recombinant HIV1 vif IIIB protein</p>

<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Anti-activated leukocyte cell adhesion mlecule (ALCAM/CD116) monoclonal antibody</p>

<p>Purified recombinant SIV mac251 p28 protein</p>

<p>Mouse monoclonal CD4 (T-cell) antibody (FITC); IgG1; 100 ug per vial; clone 45</p>

<p>The HRP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has a high affinity for streptavidin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. This antibody specifically targets the hepatocyte growth factor (HGF) and can neutralize its activity. Additionally, it has been shown to bind to other growth factors such as trastuzumab, transferrin, and epidermal growth factor (EGF). The HRP2 antibody is also capable of inhibiting the activity of tumor necrosis factor-alpha (TNF-α), which plays a crucial role in inflammation. With its ability to specifically target activated CXCR4 receptors, this antibody holds great potential in cancer research and therapeutics.</p>

<p>Purified recombinant HIV2 gp105 protein</p>

<p>Amphetamine antibody was raised in goat using amphetamine-ovalbumin as the immunogen.</p>

<p>Goat polyclonal Transferrin antibody</p>

<p>Goat polyclonal Human alpha 1 Antitrypsin antibody</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>Mouse monoclonal HIV1 Nef antibody (FITC)</p>

<p>Goat anti Human kappa + lambda light chain secondary antibody</p>

<p>Goat anti Human IgM antibody</p>

<p>Rabbit polyclonal Phosphatidylserine antibody</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Purified recombinant HIV1 Nef ELI (FITC)</p>

<p>Goat polyclonal Human Haptoglobin antibody</p>

<p>Protected amino acid</p>

<p>Goat polyclonal cAMP antibody</p>

<p>This polyclonal antibody product: affinity purified Sheep Anti-HIV-1-gp120 was produced by first immunizing sheep with a single synthetic peptide which has the amino acid sequence: APTKAKRRVVQREKR. This amino acid sequence corresponds to amino acid section 497-511 in the envelope gene gp120 protein of the BH-10 strain of HIV-1. The antibodies are then isolated from the sheep hyperimmune serum by affinity chromatography using the APTKAKRRVVQREKR sequenced synthetic peptide coupled to Sepharose. The serological activity of the antibodies is checked by ELISA and lyophilized in PBS. 0.15M NaCl (pH 7.4) without preservative.<br>The glycoprotein gp120 is an essential Human Immunodeficiency virus (HIV) envelope subunit which facilitates the entry of the HIV into CD4 T cells through binding to CD4 receptors and CCR5 or CXCR4 chemokine co-receptors on host cells. This attachment enables the second key envelope glycoprotein gp41 to form a six-helix bundle and therefore fuse to the host cell membrane. This HIV gp120 complementary antibody can be used to detect the presence of the HIV gp120 subunit in antigen detection assays such as ELISA, automated immunoassays, western blot and lateral flow.</p>

<p>Goat anti Human IgA antibody</p>

<p>CMV antibody was raised in mouse using CMV as the immunogen.</p>

<p>Estrone 6 antibody was raised in rabbit using estrone -6-oxime protein preparation as the immunogen.</p>

<p>Goat anti Human IgM antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (FITC); immunogen HIV gp41; IgG1</p>

<p>NT-proBNP Positive Human Li Heparin Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about NT-proBNP Positive Human Li Heparin Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Aldosterone-3 antibody was raised in rabbit using aldosterone-3-BSA as the immunogen.</p>

<p>Pf HRP2 antibody was raised in mouse using recombinant malaria HRP-2 antigen as the immunogen.</p>

<p>M13K07 (delta) helper phage for use in phage display technology</p>

<p>The ST2 antibody is a monoclonal antibody that has neutralizing properties against amyloid plaque. It works by binding to dopamine growth factor, which is present in human serum. This antibody is widely used in the field of life sciences for research purposes. Additionally, it has shown potential as an antiviral medicament due to its ability to inhibit the replication of certain viruses. The ST2 antibody can be used in various applications, including immunoassays and diagnostic tests. Its high specificity and affinity make it a valuable tool for studying alpha-fetoprotein and other biomarkers. With its carbon electrode technology, this monoclonal antibody offers enhanced sensitivity and accuracy in detecting target molecules.</p>

<p>Goat polyclonal anti Human Lambda light chain antibody</p>

<p>Inhibitor of PARP1 and PARP2 enzymes</p>

<p>Rabbit polyclonal BNP antibody</p>