Compuestos y reactivos bioquímicos

<p>Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>

<p>Rat Antithrombin III ELISA Kit</p>

<p>Hamster (CHO) Phospholipase B-Like 2 (PLBL2) ELISA Kit</p>

<p>Human sequence expressed in CHO Cells; purity &gt;95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>

<p>Quantify dog hemoglobin in your samples.</p>

<p>Please enquire for more information about Human Alpha 1-Antichymotrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>

<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Thiostatin ELISA Kit</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat GST alpha ELISA Kit</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>ELISA kit for the detection of Sm1 in the research laboratory</p>

<p>Monkey Cystatin C ELISA Kit</p>

<p>Quantify pig albumin in your samples.</p>

<p>Hamster (CHO) Matrix metalloproteinase-19 (MMP-19) ELISA Kit</p>

<p>Please enquire for more information about Mouse Prealbumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.<br>;</p>

<p>Horse IgG ELISA kit is intended for the quantitative determination of total horse IgG in biological samples.</p>

<p>Please enquire for more information about Rat Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Cat IgG ELISA kit is intended for the quantitative determination of total cat IgG in biological samples.</p>

<p>Rabbit IgA ELISA Kit</p>

<p>Rat Fatty Acid Binding Protein ELISA Kit</p>

<p>Cat CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cat/feline samples.</p>

<p>Canine/Dog Thymidine Kinase (TK1) ELISA Kit</p>

<p>The Pig IgG ELISA kit is intended for the quantitative determination of total pig IgG in biological samples.</p>

<p>Rabbit Plasminogen ELISA Kit</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>Fibrinogen is a glycoprotein in the blood that plays a crucial role in blood clotting and wound healing. It is produced by the liver and circulates in the blood plasma. When there is an injury that causes bleeding, fibrinogen is converted into fibrin through a series of enzymatic reactions, forming a mesh-like structure that helps to stop bleeding by forming a blood clot. This process is part of the body's natural response to injuries and is essential for maintaining hemostasis, the prevention of excessive bleeding.</p>

<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>

<p>ELISA Kit for detection of TARC in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>Influenza A Antigen Capture ELISA for use in the research laboratory</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>

<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>

<p>Sheep Haptoglobin ELISA Kit;</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>ELISA kit for the detection of Estradiol in the research laboratory</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>Biotin labeling kit for IgG</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>

<p>Hamster (CHO) Annexin A5 ELISA Kit<br> <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>

<p>Horse IgM ELISA Kit</p>

<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dog IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guinea Pig C3 ELISA Kit</p>

<p>Rat Plasminogen ELISA Kit</p>

<p>Human IgD ELISA Kit</p>

<p>The Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG in biological samples.</p>

<p>The Guinea Pig IgG ELISA kit is intended for the quantitative determination of total guinea pig IgG in biological samples.</p>

<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>For the quantitative determination of Human leucine-rich alpha-2 glycoprotein 1 (LRG1) in biological samples.</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Cat IgA ELISA Kit</p>

<p>Please enquire for more information about Dog KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse IgG2A ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The Monkey IgA ELISA kit is intended for the quantitative determination of total monkey IgA (new and old world) in biological samples.</p>

<p>Please enquire for more information about Mouse IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat C3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>Pig Fibrinogen ELISA Kit</p>

<p>Quantify total bovine IgM in your samples.</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chicken Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse CRP ELISA Kit</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine/Cow AGP ELISA Kit</p>

<p>For the quantitative determination of canine/dog albumin in biological samples.</p>