Compuestos y reactivos bioquímicos

<p>CHP antibody was raised in rabbit using the N terminal of CHP as the immunogen</p>

<p>Rabbit polyclonal MPZ antibody (FITC)</p>

<p>Met antibody is a polyclonal antibody that targets the Met receptor, also known as hepatocyte growth factor receptor (HGFR). This antibody specifically binds to the extracellular domain of the Met receptor and inhibits its activation. The Met receptor plays a crucial role in cell proliferation, survival, migration, and angiogenesis. It is involved in various physiological processes such as tissue regeneration, embryonic development, and wound healing. Dysregulation of the Met receptor has been implicated in various diseases, including cancer.</p>

<p>EDN3 antibody was raised in Rabbit using Human EDN3 as the immunogen</p>

<p>Rabbit polyclonal Rab1A antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINA5 antibody, catalog no. 70R-5417</p>

<p>THEG antibody was raised in rabbit using the middle region of THEG as the immunogen</p>

<p>Purified Polyclonal CUGBP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPRY2 antibody, catalog no. 70R-8918</p>

<p>Rabbit polyclonal CASP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP2 antibody, catalog no. 70R-10393</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS37A antibody, catalog no. 70R-2831</p>

<p>Mouse monoclonal IgG2b Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV</p>

<p>ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERH</p>

<p>Metadherin antibody was raised in Mouse using a purified recombinant fragment of human MTDH expressed in E. coli as the immunogen.</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of HIST1H2AE antibody, catalog no. 70R-10218

<p>The Met antibody is a highly activated antibody that targets the hepatocyte growth factor receptor, also known as Met. It plays a crucial role in various cellular processes such as cell growth, survival, and migration. The Met antibody has been extensively studied for its potential therapeutic applications in cancer treatment.</p>

HRP conjugated pure Human Albumin

<p>317-454 amino acids: MAANKRKNQN RNKSSSHQDS SRMSSVGDYN TSEQKQACKK HELYVSFRDL GWQDWIIAPE GYAAFYCDGE CSFPLNAHMN ATNHAIVQTL VHLMFPDHVP KPCCAPTKLN AISVLYFDDS SNVILKKYRN MVVRSCGCH</p>

<p>Rabbit polyclonal OR2A42 antibody</p>

<p>The ARG2 antibody is a highly specialized antibody that has a wide range of applications in the field of life sciences. It is commonly used in various assays and experiments to study the role of ARG2 in different biological processes.</p>

<p>Rabbit polyclonal Transgelin antibody (HRP)</p>

<p>Purified recombinant GCG protein</p>

<p>MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.</p>

<p>Purified recombinant Human PYCR1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VMD2L2 antibody, catalog no. 70R-1494</p>

<p>The Caspase 14 antibody is a specialized antibody that targets the kinase m2 enzyme. It is designed to detect and bind to specific cell antibodies, allowing for the identification and analysis of various cellular processes. This antibody has been extensively tested and validated using human serum samples, ensuring its reliability and accuracy in research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP2 antibody, catalog no. 70R-9375</p>

<p>ROR1 antibody was raised in Mouse using recombinant extracellular fragment of human ROR1 (aa30-406) fused with hIgGFc tag, expressed in HEK293 cells as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP8B2 antibody, catalog no. 70R-4519</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>EZH2 antibody was raised in Rabbit using Human EZH2 as the immunogen</p>

<p>Purified Polyclonal BCLAF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-9407</p>

<p>Purified recombinant Human BCL2A1 Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT3 antibody, catalog no. 70R-1233</p>

<p>Recombinant human SHMT1 protein (His tag)</p>

<p>The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC15A4 antibody, catalog no. 70R-6547</p>

<p>COQ9 antibody was raised in Rabbit using Human COQ9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOSIP antibody, catalog no. 70R-2310</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDOC antibody, catalog no. 70R-2334</p>

CD80 antibody was raised in Mouse using a purified recombinant fragment of CD80 expressed in E. coli as the immunogen.

<p>Claudin 9 antibody was raised using the C terminal of CLDN9 corresponding to a region with amino acids WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV</p>

<p>ARHGAP18 antibody was raised in Rabbit using Human ARHGAP18 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT5 antibody, catalog no. 70R-7239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB5 antibody, catalog no. 70R-1273</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS2B antibody, catalog no. 70R-4662</p>

<p>Region of Betacellulin protein corresponding to amino acids DGNSTRSPET NGLLCGDPEE NCAATTTQSK RKGHFSRCPK QYKHYCIKGR CRFVVAEQTP SCVCDEGYIG ARCERVDLFY.</p>

<p>The Cortactin antibody is a highly specialized product in the field of Life Sciences. It is an acidic growth factor that plays a crucial role in cellular processes such as cell migration, adhesion, and invasion. This Polyclonal Antibody specifically targets the activated form of Cortactin and can be used for various applications including immunoassays, western blotting, and immunofluorescence.</p>

<p>The beta Catenin antibody is a powerful tool used in Life Sciences research. It specifically targets the nuclear β-catenin and forms an antibody complex, allowing for the detection and analysis of this important protein. The beta Catenin antibody can be used in various applications such as transcription-polymerase chain reaction (PCR), bioassays, immunoassays, and more. Its high specificity and sensitivity make it an ideal choice for studying the role of β-catenin in cellular processes, including pluripotent stem cell differentiation and development. This antibody is available in both polyclonal and monoclonal forms to suit different experimental needs. With its ability to detect surface glycoproteins and cox-2 inhibitors, the beta Catenin antibody is an essential tool for researchers looking to gain insights into cellular signaling pathways and molecular interactions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Trim3 antibody, catalog no. 70R-9562</p>

<p>Purified Polyclonal TAF6L antibody</p>

<p>The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.</p>

<p>PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K2 antibody, catalog no. 70R-2007</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPXCR1 antibody, catalog no. 20R-1231</p>

<p>DARS antibody was raised in Rabbit using Human DARS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF8 antibody, catalog no. 70R-9919</p>

<p>Purified Avidin protein (Texas Red) from hen egg white</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JAK3 antibody, catalog no. 70R-5747</p>

<p>Sheep polyclonal DNM1 antibody (Ser778)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALX3 antibody, catalog no. 20R-1182</p>

<p>The NME1 protein is an antigen that belongs to the group of Recombinant Proteins &amp; Antigens. It contains specific epitopes that can be recognized by antibodies in human serum. This protein has a suppressive effect on viral replication and is considered to have antiviral properties. It is composed of a sequence of amino acid residues that are important for its biological activity. The NME1 protein can be used in various applications in the Life Sciences field, such as research studies and diagnostic assays. Its specific antibody can be detected using techniques like matrix-assisted laser desorption/ionization (MALDI) or lysosomal acid residues analysis.</p>

<p>Purified Goat IgG (Fc) HRP conjugate</p>

<p>CDC42EP3 antibody was raised in Rabbit using Human CDC42EP3 as the immunogen</p>

<p>The NCOR1 antibody is a highly specialized product in the field of Life Sciences. It is a colloidal solution that targets insulin and growth factor receptors. This polyclonal antibody has been extensively tested and proven to effectively bind to tyrosinase, alkaline phosphatases, epidermal growth factor, and anti-ACTH antibodies. With its high specificity and affinity for these targets, the NCOR1 antibody plays a crucial role in various research applications involving insulin signaling pathways and hormone regulation. Whether you are studying the effects of insulin on cell growth or investigating novel therapeutic approaches for diabetes, this Antibody is an essential tool for your experiments. Trust in its reliability and accuracy to deliver consistent results every time.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL4 antibody, catalog no. 70R-7155</p>

<p>Rabbit anti-mouse IgM (biotin) was raised in rabbit using murine IgM mu heavy chain as the immunogen.</p>

<p>The p27Kip1 antibody is a highly specific and potent neutralizing antibody that targets the p27Kip1 protein. This protein plays a crucial role in cell cycle regulation and acts as a tumor suppressor. The p27Kip1 antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic tool for cancer treatment.</p>

<p>Purified recombinant Human VASP protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNX5 antibody, catalog no. 70R-5748</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VIP antibody, catalog no. 70R-6661</p>

<p>The Beta Catenin antibody is a polyclonal antibody that is highly effective in targeting β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody can be used in various life science applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Itih1 antibody, catalog no. 70R-8624</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM38 antibody, catalog no. 70R-4914</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPWD1 antibody, catalog no. 70R-4237</p>

<p>CD84 antibody was raised in Rabbit using Human CD84 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPY19L1 antibody, catalog no. 70R-2918</p>

<p>HOMEZ antibody was raised in rabbit using the N terminal of HOMEZ as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF709 antibody, catalog no. 20R-1237</p>

<p>POP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRTCQKFLIQYNRRQLLILLQNCTDEGEREAIQKSVTRSCLLEEEEESGE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDOC antibody, catalog no. 70R-2603</p>

Region of Neuroserpin protein corresponding to amino acids MTGATFPEEA IADLSVNMYN RLRATGEDEN ILFSPLSIAL AMGMMELGAQ GSTQKEIRHS MGYDSLKNGE EFSFLKEFSN MVTAKESQYV MKIANSLFVQ NGFHVNEEFL QMMKKYFNAA VNHVDFSQNV AVANYINKWV ENNTNNLVKD LVSPRDFDAA TYLALINAVY FKGNWKSQFR PENTRTFSFT KDDESEVQIP MMYQQGEFYY GEFSDGSNEA GGIYQVLEIP YEGDEISMML VLSRQEVPLA TLEPLVKAQL VEEWANSVKK QKVEVYLPRF TVEQEIDLKD VLKALGITEI FIKDANLTGL SDNKEIFLSK AIHKSFLEVN EEGSEAAAVS GMIAISRMAV LYPQVIVDHP FFFLIRNRRT GTILFMGRVM HPETMNTSGH DFEEL.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PGK2 antibody, catalog no. 70R-2323</p>

<p>Affinity purified Rabbit polyclonal alpha Tubulin 1A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SETD3 antibody, catalog no. 70R-9076</p>

<p>HAL antibody was raised using the C terminal of HAL corresponding to a region with amino acids EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1D antibody, catalog no. 70R-2089</p>

<p>MAPK1 antibody was raised in rabbit using the C terminal of MAPK1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Igf2bp3 antibody, catalog no. 70R-8484</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHIC2 antibody, catalog no. 70R-6863</p>

<p>Purified recombinant Human IFN alpha G protein</p>

<p>TOR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. The potency of this drug has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Purified recombinant Human APIP Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RSU1 antibody, catalog no. 70R-1142</p>

<p>1-125 amino acids: MADEELEALR RQRLAELQAK HGDPGDAAQQ EAKHRGAEMR NSILAQVLDQ SARARLSNLA LVKPEKTKAV ENYLIQMARY GQLSEKVSEQ GLIEILKKVS QQTEKTTTVK LNRRKVMDSD EDDDY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A7 antibody, catalog no. 70R-1912</p>