Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARD6A antibody, catalog no. 70R-2600</p>

<p>Rabbit polyclonal PMFBP1 antibody</p>

<p>Borrelia burgdorferi antibody (HRP) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL</p>

<p>Purified recombinant Human CALML3 protein (His tag)</p>

<p>IL1A antibody is a monoclonal antibody that specifically targets interleukin-1 alpha (IL-1α), a cytokine involved in various inflammatory processes. IL-1α plays a crucial role in the regulation of immune responses and is associated with several diseases, including autoimmune disorders and cancer. This antibody binds to IL-1α, preventing its interaction with its receptors and blocking downstream signaling pathways. It has been shown to inhibit the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, IL1A antibody has demonstrated efficacy in multidrug-resistant cancer cell lines, suggesting its potential as a therapeutic agent. Its high affinity for IL-1α ensures effective neutralization of this cytokine, making it an essential tool for researchers in the field of life sciences.</p>

<p>Recombinant human SMS protein (His tag)</p>

<p>Rabbit polyclonal p53 antibody (Ser33)</p>

<p>Rabbit polyclonal HNRPH1 antibody (HRP)</p>

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. This active compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

<p>GAMT antibody was raised in Rabbit using Human GAMT as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT2B antibody, catalog no. 70R-1066</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EMX1 antibody, catalog no. 70R-8698</p>

<p>Purified Polyclonal Apolipoprotein L6 antibody</p>

<p>HCCS antibody was raised in rabbit using the C terminal of HCCS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NAT12 antibody, catalog no. 70R-2955</p>

<p>CNTN4 antibody was raised in Rabbit using Human CNTN4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MEPE antibody, catalog no. 70R-8188</p>

<p>CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA</p>

<p>Purified Rabbit polyclonal Tip60 antibody (Ser90)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCP10 antibody, catalog no. 70R-2960</p>

<p>Purified Polyclonal FASTKD2 antibody</p>

<p>FABP3 antibody was raised in Rabbit using Human FABP3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GUK1 antibody, catalog no. 70R-2009</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RFPL3 antibody, catalog no. 70R-9563</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF284 antibody, catalog no. 70R-7891</p>

<p>The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.</p>

<p>HIV1 gp120 antibody (HRP) was raised in goat using purified native gp120 from strain IIIB as the immunogen.</p>

<p>GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF607 antibody, catalog no. 70R-8098

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFNG antibody, catalog no. 70R-5287</p>

<p>MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OLFML2A antibody, catalog no. 70R-4200</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF100 antibody, catalog no. 70R-8153</p>

<p>Rabbit polyclonal Thioredoxin antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R3A antibody, catalog no. 70R-6844</p>

<p>RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAE</p>

<p>Purified Polyclonal UBE4A antibody</p>

<p>Rabbit anti-mouse IgM (Alk Phos) was raised in rabbit using murine IgM heavy chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Med19 antibody, catalog no. 70R-9337</p>

<p>The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.</p>

<p>FAS antibody was raised in rabbit using the N terminal of FAS as the immunogen</p>

<p>CD3e antibody was raised in hamster using CD3e as the immunogen.#</p>

<p>RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTN2 antibody, catalog no. 70R-1068</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf54 antibody, catalog no. 70R-3576</p>

<p>CHAD antibody was raised in Rabbit using Human CHAD as the immunogen</p>

<p>Rabbit polyclonal EIF4A2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEK11 antibody, catalog no. 70R-2292</p>

<p>ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDCD7 antibody, catalog no. 70R-6011</p>

<p>Purified recombinant Human PSME1 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Il5 antibody, catalog no. 70R-9263</p>

<p>Rabbit polyclonal ASAH3L antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL1 antibody, catalog no. 70R-7382</p>

<p>HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD</p>

<p>The ATF2 antibody is a highly specialized immunogenic composition that belongs to the family of monoclonal antibodies. It is specifically designed to target and inhibit the activity of ATF2, a protein kinase involved in various cellular processes. This antibody has been extensively studied and proven to effectively block the function of ATF2, making it a valuable tool for researchers studying signal transduction pathways and gene expression regulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF382 antibody, catalog no. 20R-1228</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALAS2 antibody, catalog no. 70R-2482</p>

<p>The RELT antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that has been specifically developed to target and neutralize the activity of hepcidin, a growth factor involved in various physiological processes. This antibody has been extensively tested and proven to effectively inhibit hepcidin-induced syncytia formation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM1 antibody, catalog no. 70R-8515</p>

<p>The FZD5 antibody is a monoclonal antibody that targets the frizzled-5 receptor, a member of the frizzled family of proteins. This receptor plays a crucial role in the Wnt signaling pathway, which is involved in various cellular processes such as cell proliferation, differentiation, and migration. The FZD5 antibody specifically binds to the activated form of the frizzled-5 receptor, blocking its interaction with Wnt ligands and preventing downstream signaling events.</p>

<p>Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PI3 antibody, catalog no. 70R-7380</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf24 antibody, catalog no. 70R-4955</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLC3 antibody, catalog no. 70R-2518</p>

<p>Cytokeratin 7 antibody was raised in Mouse using a purified recombinant fragment of human CK7 expressed in E. coli as the immunogen.</p>

<p>DNAJB2 antibody was raised in Rabbit using Human DNAJB2 as the immunogen</p>

<p>Plasminogen antibody was raised in goat using human plasminogen purified from plasma as the immunogen.</p>

<p>The ABL1 antibody is a powerful tool used in the field of Life Sciences for various applications. It is an antibody specifically designed to target and bind to the ABL1 protein, which plays a crucial role in cell signaling and regulation. This antibody can be used for research purposes, such as studying the function of ABL1 in different cellular processes or investigating its involvement in diseases like cancer.</p>

<p>CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.</p>

<p>TNFRSF14 antibody was raised in rabbit using the middle region of TNFRSF14 as the immunogen</p>

<p>PEA15 antibody was raised in rabbit using the C terminal of PEA15 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9794</p>

<p>OVA antibody was raised in Mouse using Ovalbumin as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal SRPX antibody</p>

<p>Cyb5r2 antibody was raised in rabbit using the C terminal of Cyb5r2 as the immunogen</p>

<p>TRIM48 antibody was raised in rabbit using the C terminal of TRIM48 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DSCAM antibody, catalog no. 70R-6114</p>

<p>Rabbit polyclonal CCRK antibody</p>

<p>ACOT9 antibody was raised in rabbit using the C terminal of ACOT9 as the immunogen</p>

<p>MED1 antibody is a protein that belongs to the category of polyclonal antibodies. It is commonly used in the field of life sciences for various applications. MED1 antibody specifically targets erythropoietin, adalimumab, and other autoantibodies. It can also be used to detect and measure levels of androgen, TGF-beta, alpha-fetoprotein, interferon, and other growth factors. This specific antibody provides researchers with a valuable tool for studying the role of these proteins in various biological processes and diseases. With its high specificity and sensitivity, MED1 antibody ensures accurate and reliable results in experiments and diagnostic assays.</p>

<p>LOC390738 antibody was raised in rabbit using the middle region of LOC390738 as the immunogen</p>

<p>The GluR4 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used in studies involving glutamate receptors and their role in various biological processes. This antibody specifically targets the GluR4 subunit, which is known to be involved in neuronal excitability and synaptic plasticity.</p>

<p>Purified Dog IgG (Fc)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH3 antibody, catalog no. 70R-1708</p>

<p>Rabbit polyclonal VOPP1 antibody</p>

<p>Rabbit polyclonal AFG3L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEGR1 antibody, catalog no. 70R-9341</p>

<p>The AQP1 antibody is a monoclonal antibody that targets the aquaporin-1 (AQP1) protein. Aquaporins are a family of water channel proteins that play a crucial role in regulating water transport across cell membranes. AQP1 is specifically expressed in endothelial cells, where it facilitates the movement of water and small solutes across blood vessels.</p>

<p>Purified Polyclonal LZK antibody</p>

<p>CHRNA9 antibody was raised in rabbit using the N terminal of CHRNA9 as the immunogen</p>

<p>Purified recombinant Human UBL4A protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1A antibody, catalog no. 70R-3013</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARID5A antibody, catalog no. 70R-9027</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NCL antibody, catalog no. 70R-4742</p>

<p>AGR3 antibody was raised in Rabbit using Human AGR3 as the immunogen</p>

<p>Desmoglein 4 antibody is an antiviral agent that is commonly used in Life Sciences research. It is a high-flux antibody that can be used for staining and detection purposes. This antibody specifically targets desmoglein 4, which is an extracellular antigen involved in cell adhesion. Desmoglein 4 antibody can be used as a serum marker to detect the presence of this antigen in various biological samples. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs. This antibody has potential applications in chemotherapy, as well as in the study of interleukins and autoantibodies. With its versatility and specificity, desmoglein 4 antibody offers researchers a valuable tool for their investigations in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LCOR antibody, catalog no. 70R-9910</p>

<p>CLASP2 antibody was raised in Rabbit using Human CLASP2 as the immunogen</p>