Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.205 productos)
- Por objetivo biológico(99.900 productos)
- Según efectos farmacológicos(6.790 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.835 productos)
- Metabolitos secundarios(14.345 productos)
Se han encontrado 130607 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD4 antibody (biotin)
<p>CD4 antibody (biotin) was raised in mouse using feline CD4 as the immunogen.</p>CDH1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH1 antibody, catalog no. 70R-9719</p>Pureza:Min. 95%LPP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LPP antibody, catalog no. 70R-2082</p>Pureza:Min. 95%ZNF33A antibody
<p>ZNF33A antibody was raised using the middle region of ZNF33A corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD</p>IgG1 Isotype Control Fc fusion protein (PE)
<p>Rat monoclonal IgG1 Isotype Control Fc fusion protein (PE)</p>Pureza:Min. 95%MuSK antibody
<p>MuSK antibody was raised in Mouse using purified recombinant extracellular fragment of human MuSK (aa24-209) fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.</p>AK2 protein (His tag)
<p>1-239 amino acids: MGSSHHHHHH SSGLVPRGSH MAPSVPAAEP EYPKGIRAVL LGPPGAGKGT QAPRLAENFC VCHLATGDML RAMVASGSEL GKKLKATMDA GKLVSDEMVV ELIEKNLETP LCKNGFLLDG FPRTVRQAEM LDDLMEKRKE KLDSVIEFSI PDSLLIRRIT GRLIHPKSGR SYHEEFNPPK EPMKDDITGE PLIRRSDDNE KALKIRLQAY HTQTTPLIEY YRKRGIHSAI DASQTPDVVF ASILAAFSKA TCKDLVMFI</p>Pureza:Min. 95%PODXL Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PODXL antibody, catalog no. 70R-6251</p>Pureza:Min. 95%THEG antibody
<p>THEG antibody was raised in rabbit using the middle region of THEG as the immunogen</p>Pureza:Min. 95%TAFA2 protein
<p>Region of TAFA2 protein corresponding to amino acids MANHHKAHHV KTGTCEVVAL HRCCNKNKIE ERSQTVKCSC FPGQVAGTTR AAPSCVDASI VEQKWWCHMQ PCLEGEECKV LPDRKGWSCS SGNKVKTTRV TH.</p>Pureza:Min. 95%GCSF antibody
<p>GCSF antibody was raised in rabbit using highly pure recombinant human G-CSF as the immunogen.</p>Pureza:Min. 95%NBN antibody
<p>The NBN antibody is a highly effective immunomodulatory agent that has the ability to modulate the immune response by targeting interleukins and pyroptotic cells. It specifically interacts with inflammasome proteins, which are crucial for the activation of inflammatory responses. This antibody exhibits opsonophagocytic activity, enhancing the ability of immune cells to engulf and eliminate pathogens. Through advanced cytometry analysis, it has been shown to promote the production of antibody-secreting cells, leading to a stronger immune response. The NBN antibody can be used in various life science applications, including fluorescent assays and protein complex studies. With its potent capabilities and specificity, this monoclonal antibody is a valuable tool for researchers in the field of immunology.</p>Glycoprotein Ib Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GP1BA antibody, catalog no. 70R-6193Pureza:Min. 95%MAP3K15 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K15 antibody, catalog no. 70R-2087</p>Pureza:Min. 95%Progesterone Receptor antibody
<p>The Progesterone Receptor antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the progesterone receptor, a protein involved in various cellular processes. It can be used to study the role of progesterone signaling in development, reproduction, and cancer.</p>RP11-529I10.4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-529I10.4 antibody, catalog no. 70R-2999</p>Pureza:Min. 95%OVGP1 antibody
<p>OVGP1 antibody was raised in rabbit using the C terminal of OVGP1 as the immunogen</p>GPR161 antibody
<p>GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV</p>Commd2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Commd2 antibody, catalog no. 70R-9447</p>Pureza:Min. 95%GBA antibody
<p>The GBA antibody is a polyclonal antibody that specifically targets the primary amino acid sequence of the glucocerebrosidase (GBA) enzyme. This antibody is derived from human serum and has been extensively validated for its specificity and sensitivity. It can be used in various applications, including enzyme-linked immunosorbent assays (ELISAs), Western blotting, and immunohistochemistry.</p>STK38L antibody
<p>STK38L antibody was raised using the middle region of STK38L corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK</p>SF4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF4 antibody, catalog no. 70R-4961</p>Pureza:Min. 95%CD32 antibody (Fab 2)
<p>CD32 antibody (Fab'2) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.</p>DEDD antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its exceptional efficacy in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes. Extensive research has shown its high affinity towards human erythrocytes using the patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>Glycine dehydrogenase antibody
<p>Affinity purified Rabbit polyclonal Glycine dehydrogenase antibody</p>ZNF547 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF547 antibody, catalog no. 20R-1098</p>Pureza:Min. 95%Goat anti Rat IgG (H + L) (FITC)
<p>Goat anti-rat IgG (H+L) (FITC) was raised in goat using rat IgG whole molecule as the immunogen.</p>Pureza:Min. 95%C9ORF75 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf75 antibody, catalog no. 70R-3687</p>Pureza:Min. 95%RWDD4A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD4A antibody, catalog no. 70R-3398</p>Persephin protein
<p>Region of Persephin protein corresponding to amino acids ALAGSCRLWS LTLPVAELGL GYASEEKVIF RYCAGSCPQE ARTQHSLVLA RLRGRGRAHG RPCCQPTSYA DVTFLDDQHH WQQLPQLSAA ACGCGG.</p>Pureza:Min. 95%RPS21 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS21 antibody, catalog no. 70R-2535</p>Pureza:Min. 95%UXT antibody
<p>UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL</p>SAAL1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SAAL1 antibody, catalog no. 70R-4566</p>Pureza:Min. 95%MMP13 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MMP13 antibody, catalog no. 70R-5295</p>Pureza:Min. 95%ATE1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATE1 antibody, catalog no. 70R-2256</p>Pureza:Min. 95%Carbonic Anhydrase VIII Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA8 antibody, catalog no. 70R-1122</p>Pureza:Min. 95%Progesterone Receptor Antibody
<p>The Progesterone Receptor Antibody is a highly reactive monoclonal antibody that specifically targets the progesterone receptor. It can be used for various applications, including research and diagnostic purposes. The antibody binds to the progesterone receptor with high affinity, allowing for accurate detection and quantification of the receptor in samples.</p>Goat anti Human IgM (mu chain) (biotin)
<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>Pureza:Min. 95%MAPK3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK3 antibody, catalog no. 70R-5573</p>Pureza:Min. 95%ATP6V1B1 antibody
<p>The ATP6V1B1 antibody is a glycopeptide that acts as an anti-connexin agent. It belongs to the group of polyclonal antibodies and has colloidal properties. This antibody is capable of neutralizing estrogen receptors and hormone peptides, making it useful in various applications within the field of Life Sciences. Additionally, the ATP6V1B1 antibody has neuroprotective properties and plays a role in glycan and glycosylation processes. It is important to note that this antibody should be handled with care, as it may have teratogenic effects. With its high specificity and effectiveness, the ATP6V1B1 antibody is an invaluable tool for researchers and scientists working in the field of peptide agents. Both its monoclonal and polyclonal forms are available, providing flexibility for different experimental needs.</p>Rabbit anti Rat IgG (H + L) (biotin)
<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>Pureza:Min. 95%Goat anti Mouse IgG (Fab'2) (HRP)
<p>Goat anti-mouse IgG (Fab'2) (HRP) was raised in goat using murine IgG F(c) whole molecule as the immunogen.</p>Pureza:Min. 95%PPHLN1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPHLN1 antibody, catalog no. 70R-9552</p>Pureza:Min. 95%IL6 antibody
<p>IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.</p>CDK4 protein
<p>CDK4 protein is a test substance that plays a crucial role in cell cycle regulation. It is an activated form of cyclin-dependent kinase that exhibits cyclin D1/CDK4 activity. CDK4 protein is commonly used in Life Sciences research to study the mechanisms of cell division and proliferation.</p>Pureza:Min. 95%BLK Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BLK antibody, catalog no. 70R-1644</p>Pureza:Min. 95%CACNB2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-1509</p>Pureza:Min. 95%PYGB Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PYGB antibody, catalog no. 70R-2554</p>Pureza:Min. 95%CD326 antibody
<p>The CD326 antibody is a monoclonal antibody that specifically targets the epidermal growth factor protein. It is commonly used in Life Sciences research to study the role of this protein in various cellular processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry.</p>Legionella pneumophila antibody (HRP)
<p>Legionella pneumophila antibody (HRP) was raised in rabbit using a whole cell preparation of Legionella pneumophila; ATCC #33152 as the immunogen.</p>ApoH antibody
<p>ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG</p>JIP3 antibody
<p>The JIP3 antibody is a highly effective and versatile tool used in various assays and research studies in the field of Life Sciences. This antibody specifically targets chloride, anti-mesothelin, telomerase, and other glycoproteins, making it an essential component for the detection and analysis of these markers. With its high-flux binding capabilities, this antibody ensures accurate and reliable results in serum marker analysis.</p>NDUFS3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFS3 antibody, catalog no. 70R-2515</p>Pureza:Min. 95%DNA PKcs antibody
<p>The DNA PKcs antibody is a highly specialized polyclonal antibody that targets the DNA-dependent protein kinase catalytic subunit (DNA PKcs). It is commonly used in research and laboratory settings to study various cellular processes involving DNA repair, recombination, and transcription. This antibody specifically recognizes and binds to the DNA PKcs protein, allowing researchers to investigate its role in different biological pathways.</p>ZHX2 antibody
<p>The ZHX2 antibody is a protein reagent used in Life Sciences research. It is a polyclonal antibody that specifically targets and inhibits cytokines. This antibody is widely used in various experiments and studies to investigate the role of cytokines in different biological processes. With its high specificity and potency, the ZHX2 antibody is an essential tool for researchers in the field of immunology and molecular biology. Whether you are studying immune responses, inflammation, or cell signaling pathways, this antibody can provide valuable insights into the mechanisms underlying these processes. Trust the ZHX2 antibody to deliver reliable results and contribute to advancements in scientific knowledge.</p>SFRS8 antibody
<p>SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE</p>AIMP2 antibody
<p>AIMP2 antibody was raised in rabbit using the N terminal of AIMP2 as the immunogen</p>Pureza:Min. 95%ATP2A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATP2A1 antibody, catalog no. 70R-6261Pureza:Min. 95%Rotavirus VP6 protein (His tag)
<p>Purified recombinant Rotavirus VP6 protein (His tag)</p>Pureza:Min. 95%RORA antibody
<p>RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS</p>
