Compuestos y reactivos bioquímicos

<p>The DROSHA antibody is a high-quality monoclonal antibody used in the field of Life Sciences. It specifically targets the glycoprotein DROSHA, which plays a crucial role in the processing of microRNAs. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Region of Neurturin protein corresponding to amino acids ARLGARPCGL RELEVRVSEL GLGYASDETV LFRYCAGACE AAARVYDLGL RRLRQRRRLR RERVRAQPCC RPTAYEDEVS FLDAHSRYHT VHELSARECA CV.</p>

<p>Mouse monoclonal CD19 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal SYNCRIP antibody (biotin)</p>

<p>CD25 antibody was raised in rat using IL-2-dependent BALB/c murine helper T-cell as the immunogen.</p>

<p>CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI</p>

<p>Rabbit polyclonal SLC25A46 antibody</p>

<p>Rabbit polyclonal ADAMTS18 antibody</p>

<p>Purified Polyclonal DJ1 antibody</p>

<p>USP20 antibody was raised in rabbit using the middle region of USP20 as the immunogen</p>

The PGM1 antibody is a highly specialized antibody that targets elastase and annexin A2. It is commonly used in life sciences research, particularly in the field of insulin studies. This antibody has been extensively tested and proven to be effective in detecting insulin and its related proteins in various samples, including human serum and tissue samples.

<p>PRTFDC1 antibody was raised using the middle region of PRTFDC1 corresponding to a region with amino acids MKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYA</p>

<p>Purified recombinant Human PKIB protein</p>

<p>Rabbit polyclonal THRB antibody</p>

<p>FEM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE</p>

<p>MTUS1 antibody was raised using the N terminal of MTUS1 corresponding to a region with amino acids QLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTAST</p>

<p>Rabbit polyclonal DDX19B antibody</p>

<p>Purified Rabbit polyclonal OR7C2 antibody</p>

<p>ZNF680 antibody was raised in rabbit using the N terminal of ZNF680 as the immunogen</p>

<p>Rabbit polyclonal NDUFB1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNGR2 antibody, catalog no. 70R-6322</p>

<p>Purified recombinant COMMD9 protein (His tag)</p>

<p>Rabbit polyclonal PIP5K antibody</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Purified recombinant Human RAP1A protein</p>

<p>TNFAIP8L1 antibody was raised using the middle region of TNFAIP8L1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL</p>

<p>Purified recombinant DTD1 protein</p>

<p>LAT3 antibody is a monoclonal antibody that is used as a medicament in the field of Life Sciences. It specifically targets arginase, an enzyme involved in the metabolism of arginine. By blocking the activity of arginase, LAT3 antibody helps to regulate the levels of arginine in the body, which can have various biochemical effects. This antibody has been extensively studied and characterized using hybridoma cell lines and isolated nucleic acids. It has shown high affinity for its target and exhibits excellent specificity for human proteins. LAT3 antibody is widely used in research laboratories and pharmaceutical companies for a variety of applications, including protein analysis, immunohistochemistry, and drug development. Whether you need a monoclonal or polyclonal antibody, LAT3 antibody is a reliable choice that delivers consistent results.</p>

<p>The CADM1 antibody is a high-quality antibody used in various immunocytochemical studies. It specifically targets the human protein CADM1, which plays a crucial role in cell adhesion and signaling. This antibody is produced using recombinant protein technology, ensuring its specificity and reliability.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PINX1 antibody, catalog no. 70R-2144</p>

<p>The Raf1 antibody is a polyclonal antibody that specifically targets the Raf1 protein. It is commonly used in the field of life sciences for research purposes. The Raf1 protein plays a crucial role in cell signaling pathways, particularly in the regulation of cell growth and differentiation. This antibody can be used to detect and quantify the expression levels of Raf1 in various samples, such as serum or tissue extracts. It is highly specific and sensitive, making it a valuable tool for studying the function and activity of Raf1 in different biological processes. Researchers often rely on this antibody to investigate the involvement of Raf1 in diseases like cancer, cardiovascular disorders, and neurological conditions. Its high affinity for the target antigen ensures accurate and reliable results, making it an essential component in many scientific studies.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>BAK1 antibody was raised in mouse using recombinant human BAK1 (29-187aa) purified from E.coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rerg antibody, catalog no. 70R-9848</p>

<p>The SOX17 antibody is a highly specialized monoclonal antibody that targets the HER2 protein. It works by binding to β-catenin, a protein involved in cell signaling pathways, and inhibiting its function. This antibody has been extensively tested and has shown excellent results in low-density lipoprotein (LDL) receptor-deficient mice. Additionally, it has been found to have synergistic effects when used in combination with other therapeutic agents such as interferon, caffeine, transferrin, and trastuzumab.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ10490 antibody, catalog no. 70R-9475</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B3 antibody, catalog no. 70R-4646</p>

<p>LYZL4 antibody was raised in Rabbit using Human LYZL4 as the immunogen</p>

<p>Hamster RBC antibody (FITC) was raised in rabbit using hamster erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal SCAMP2 antibody</p>

<p>PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.</p>

<p>LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP16 antibody, catalog no. 70R-6276</p>

<p>The RAC1 antibody is a monoclonal antibody that specifically targets the RAC1 protein complex. This antibody has a high affinity for RAC1 and can neutralize its activity. It is formulated with excipients such as globulin to ensure stability and effectiveness. The RAC1 antibody belongs to the family of Polyclonal Antibodies, which are widely used in Life Sciences research. It can be used as an antigen in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody is particularly useful for studying the role of RAC1 in cell growth, as well as its interaction with other proteins such as growth factors and mineralocorticoid receptors. Additionally, it has been shown to have low cross-reactivity with other proteins or lipoproteins. Researchers and scientists can rely on the high quality and specificity of this RAC1 antibody for their experiments and studies.</p>

<p>CDC5L antibody was raised in Rabbit using Human CDC5L as the immunogen</p>

<p>The HSPA9 antibody is a powerful tool in the field of Life Sciences. It targets the HSPA9 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research related to epidermal growth factor, erythropoietin, e-cadherin, ketanserin, trastuzumab, and anti-HER2 antibody.</p>

<p>Rabbit polyclonal MCSFR antibody (Tyr723)</p>

<p>KIF3A antibody was raised in Rabbit using Human KIF3A as the immunogen</p>

<p>Mouse monoclonal AKR1A1 antibody</p>

<p>PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH</p>

<p>CCNB1 antibody was raised in Rabbit using Human CCNB1 as the immunogen</p>

<p>HSPA9 antibody was raised in rabbit using the C terminal of HSPA9 as the immunogen</p>

<p>KCTD10 antibody was raised using the middle region of KCTD10 corresponding to a region with amino acids EETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI</p>

<p>Rabbit polyclonal PSMA6 antibody</p>

<p>Rabbit polyclonal OSGIN1 antibody</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>Recombinant human MYL5 protein</p>

<p>The SERPINB2 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of human serum, including fatty acid metabolism, glutamate signaling, growth factors, and angiogenesis. This monoclonal antibody has been specifically designed to target and bind to SERPINB2, a protein involved in regulating several important biological processes.</p>

<p>Rabbit polyclonal RANK antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALOX12 antibody, catalog no. 70R-3235</p>

<p>IMMT antibody was raised in Rabbit using Human IMMT as the immunogen</p>

<p>The TIM antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which plays a crucial role in cell proliferation and differentiation. The TIM antibody can be used in research related to heparin-induced thrombocytopenia, where it helps in identifying and studying the mechanisms involved in this condition.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA4 antibody, catalog no. 70R-4207</p>

<p>CEBPZ antibody was raised in rabbit using the middle region of CEBPZ as the immunogen</p>

<p>Rabbit polyclonal ACV1B antibody</p>

<p>Affinity purified Rabbit polyclonal MEL1AR antibody</p>

<p>Mouse monoclonal PIP4K2A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-1369</p>

<p>The NPM1 antibody is a diagnostic reagent used in Life Sciences. It belongs to the group of antibodies that target annexin A2, which is a protein involved in various cellular processes. This antibody specifically recognizes and binds to annexin A2, making it a valuable tool for research and diagnostic purposes. Additionally, the NPM1 antibody can be used in recombinant cells to study the function of annexin A2 and its binding partners. It can also be used as a therapeutic agent or as part of a medicament for the treatment of diseases related to annexin A2 dysregulation. With its high specificity and affinity, this monoclonal antibody offers great potential in advancing scientific knowledge and improving patient care.</p>

<p>Mouse monoclonal TNF alpha antibody (PE)</p>

<p>Purified Polyclonal MEOX2 antibody</p>

<p>Rat monoclonal IgG2a Isotype Control Fc fusion protein (FITC)</p>

<p>Purified recombinant CRTAP protein (His tag)</p>

<p>Vinculin antibody was raised in mouse using human vinculin as the immunogen.</p>

<p>Purified Polyclonal Cotinine-3 Antibody</p>

<p>Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF570 antibody, catalog no. 70R-8409</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIPH antibody, catalog no. 70R-10356</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pitx1 antibody, catalog no. 70R-7963</p>

<p>CLUAP1 antibody was raised in rabbit using the C terminal of CLUAP1 as the immunogen</p>

<p>Rabbit polyclonal MRGRE antibody</p>

<p>Sheep polyclonal Normeperidine antibody</p>

<p>Rabbit polyclonal SV2B antibody</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Purified recombinant Human CLIC4 protein</p>

<p>Oct 3/4 antibody was raised in rabbit using an internal sequence of the human Oct 3/4 protein as the immunogen.</p>

<p>The AKR1C1 antibody is a monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and binds to AKR1C1, a protein that is involved in various cellular processes. This antibody has been shown to be effective in detecting the presence of AKR1C1 in samples such as human serum and tissue sections.</p>

<p>IL31 antibody was raised in rabbit using highly pure recombinant human IL-31 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BACE2 antibody, catalog no. 70R-6559</p>

<p>KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC</p>

<p>The Ezrin antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It is an essential tool for researchers in the Life Sciences field, particularly those studying cell signaling pathways and protein interactions.</p>

<p>Purified recombinant Human FGFR2 protein (Fc Chimera)</p>

<p>Rabbit polyclonal RANBP10 antibody</p>

<p>Mouse monoclonal C15orf40 antibody</p>

<p>Affinity purified Rabbit polyclonal Fumarate Hydratase antibody</p>

<p>Recombinant human KPNB1 protein (His tag)</p>