Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.179 productos)
- Por objetivo biológico(99.902 productos)
- Según efectos farmacológicos(6.790 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.846 productos)
- Metabolitos secundarios(14.327 productos)
Se han encontrado 130590 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
VNN2 antibody
<p>VNN2 antibody was raised in rabbit using the C terminal of VNN2 as the immunogen</p>SDS antibody
<p>SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI</p>TRIM23 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM23 antibody, catalog no. 20R-1190</p>Pureza:Min. 95%Fibrinogen antibody (HRP)
<p>Fibrinogen antibody (HRP) was raised in sheep using Rabbit Fibrinogen purified from plasma as the immunogen.</p>Mycoplasma pneumoniae antibody
<p>Mycoplasma pneumoniae antibody is a monoclonal antibody that specifically targets the antigen-antibody reaction associated with Mycoplasma pneumoniae infection. This antibody is highly reactive and can effectively neutralize the autoantibodies produced during an infection, reducing cytotoxic effects on host cells. The bioavailability of this antibody is enhanced by its conjugation to cellulose, which allows for targeted delivery to infected cells. In addition to its neutralizing properties, this antibody also activates cell cytotoxicity mechanisms, further enhancing its effectiveness in combating Mycoplasma pneumoniae. Monoclonal Antibodies against annexin A2 have also been developed as therapeutic agents for Mycoplasma pneumoniae infections.</p>GFM2 antibody
<p>GFM2 antibody was raised in rabbit using the C terminal of GFM2 as the immunogen</p>MFAP3L Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFAP3L antibody, catalog no. 70R-1726</p>Pureza:Min. 95%TGDS antibody
<p>TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR</p>PPIA antibody
<p>PPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE</p>Lamin B2 antibody
<p>The Lamin B2 antibody is a highly specialized antibody that targets autoantibodies in cardiomyocytes. It is also effective against anti-mesothelin antibodies. This antibody plays a crucial role in the field of Life Sciences and medicine, as it serves as a serum marker for various diseases and conditions. The Lamin B2 antibody has been shown to interact with dopamine, which is involved in numerous physiological processes. Additionally, this antibody has the ability to activate methyltransferase enzymes and modulate interleukin levels. Furthermore, it influences the release of acetylcholine and regulates transmembrane conductance. With its unique properties and high specificity, the Lamin B2 antibody is an essential tool for researchers and healthcare professionals alike.</p>Hspb7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Hspb7 antibody, catalog no. 70R-8510</p>Pureza:Min. 95%PPM1M Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPM1M antibody, catalog no. 70R-3594</p>Pureza:Min. 95%CAMK1G antibody
<p>CAMK1G antibody was raised using the middle region of CAMK1G corresponding to a region with amino acids KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA</p>HER2 antibody
<p>The HER2 antibody, also known as trastuzumab, is a highly effective cytotoxic agent used in the treatment of various cancers. This monoclonal antibody specifically targets the HER2 receptor, a glycoprotein that plays a crucial role in cell growth and division. By binding to the HER2 receptor, trastuzumab inhibits its activity and prevents the growth and proliferation of cancer cells.</p>Pureza:Min. 95%C19ORF28 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf28 antibody, catalog no. 70R-6785</p>Pureza:Min. 95%RBM4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM4 antibody, catalog no. 70R-4829</p>Pureza:Min. 95%RAD50 antibody
<p>The RAD50 antibody is a collagen-based monoclonal antibody used in bioassays within the Life Sciences field. It is designed for intraocular use and can be immobilized on microspheres or colloidal particles for ultrasensitive detection. This antibody demonstrates high reactivity with human serum, making it an ideal tool for various diagnostic applications. Additionally, the RAD50 antibody can be used in electrode-based assays to detect the presence of growth factors and other biomarkers. Its specificity and reliability have been validated through extensive testing using hybridoma cells that produce this monoclonal antibody.</p>PCBP2 antibody
<p>PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE</p>TAF15 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAF15 antibody, catalog no. 70R-4631</p>Pureza:Min. 95%Lipoprotein Lipase Antibody
<p>Lipoprotein Lipase Antibody is a potent monoclonal antibody that specifically targets and neutralizes the activity of lipoprotein lipase (LPL). LPL is an enzyme that plays a crucial role in lipid metabolism, particularly in adipose tissue. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>PLA2G5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLA2G5 antibody, catalog no. 70R-5272</p>Pureza:Min. 95%Merlin antibody
<p>The Merlin antibody is a highly specialized monoclonal antibody that targets specific proteins involved in various physiological processes. It has been shown to have a significant impact on the regulation of erythropoietin and endothelial growth factor, both of which play crucial roles in cell growth and development. Additionally, the Merlin antibody has been found to interact with androgen receptors, modulating their activity and influencing hormone response.</p>Pureza:Min. 95%DDHD2 antibody
<p>DDHD2 antibody was raised using the N terminal of DDHD2 corresponding to a region with amino acids DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD</p>HYOU1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYOU1 antibody, catalog no. 70R-6400</p>Pureza:Min. 95%Goat anti Human IgA (alpha chain) (HRP)
<p>Goat anti-Human IgA (alpha chain) (HRP) was raised in goat using purified Human IgA as the immunogen.</p>Pureza:Min. 95%FLJ44894 antibody
<p>FLJ44894 antibody was raised in rabbit using the middle region of FLJ44894 as the immunogen</p>Pureza:Min. 95%FBXO24 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO24 antibody, catalog no. 70R-2810</p>Pureza:Min. 95%LTK Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LTK antibody, catalog no. 70R-10027</p>Pureza:Min. 95%C17ORF80 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf80 antibody, catalog no. 70R-6883</p>Pureza:Min. 95%RNF39 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF39 antibody, catalog no. 70R-3093</p>Pureza:Min. 95%UBE2L3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2L3 antibody, catalog no. 70R-2746</p>Pureza:Min. 95%PIAS2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIAS2 antibody, catalog no. 70R-2646</p>Pureza:Min. 95%Factor XI antibody (biotin)
<p>Factor XI antibody (biotin) was raised in goat using human Factor XI purified from plasma as the immunogen.</p>PDP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDP2 antibody, catalog no. 70R-3847</p>Pureza:Min. 95%TIMELESS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TIMELESS antibody, catalog no. 20R-1199</p>Pureza:Min. 95%MAP2K3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K3 antibody, catalog no. 70R-2685</p>Pureza:Min. 95%DDX4 antibody
<p>DDX4 antibody was raised in Mouse using a purified recombinant fragment of human DDX4 expressed in E. coli as the immunogen.</p>P2ry1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2ry1 antibody, catalog no. 70R-9082</p>Pureza:Min. 95%TFPI antibody
<p>TFPI antibody was raised in sheep using Synthetic peptide corresponding to NH-terminus of human TFPI conjugated to carrier as the immunogen.</p>Pureza:Min. 95%Decorin Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCN antibody, catalog no. 70R-5385</p>Pureza:Min. 95%ZBTB43 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB43 antibody, catalog no. 70R-8305</p>Pureza:Min. 95%FSCN3 antibody
<p>FSCN3 antibody was raised in rabbit using the C terminal of FSCN3 as the immunogen</p>Pureza:Min. 95%Donkey anti Goat IgG (H + L) (Alk Phos)
<p>Donkey anti-goat IgG (H+L) (Alk Phos) was raised in donkey using goat IgG whole molecule as the immunogen.</p>Pureza:Min. 95%Norovirus genogroup I Antigen
<p>Norovirus genogroup I Antigen is a recombinant protein used for diagnostic purposes. It is commonly used in polymerase chain reaction (PCR) assays and electrochemical impedance-based techniques to detect the presence of norovirus genogroup I. This antigen is designed with specific amino acid residues that mimic the antigen binding domain of the virus, allowing for accurate detection in clinical samples such as human serum and plasma. The microsphere composition and crystal microbalance technology enhance the sensitivity of the assay, ensuring reliable results. This Norovirus genogroup I Antigen is widely used in life sciences research and clinical diagnostics to identify and monitor norovirus infections.</p>Pureza:Min. 95%7α-Hydroxy-3-oxo-4-cholestenoic acid
CAS:Producto controlado<p>7α-Hydroxy-3-oxo-4-cholestenoic acid is a fatty acid that is synthesized by the liver. This compound has been shown to have health effects, including increasing the production of monoclonal antibodies in mice and protecting brain cells from damage in rats. 7α-Hydroxy-3-oxo-4-cholestenoic acid also has an acidic nature and can form hydrogen ions when metabolized. It can be toxic to humans, with high doses causing liver damage. The metabolites of 7α-hydroxycholesterols are known to play a role in cancer progression and may be involved in the development of malignant melanoma cells.</p>Fórmula:C27H42O4Pureza:Min. 95%Peso molecular:430.62 g/molTPH2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPH2 antibody, catalog no. 70R-2011</p>Pureza:Min. 95%RBPMS antibody
<p>RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ</p>OAS1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OAS1 antibody, catalog no. 70R-9084</p>Pureza:Min. 95%Fatty Acid Synthase antibody
<p>The Fatty Acid Synthase antibody is a highly specialized protein used in Life Sciences research. It is an essential tool for studying the role of fatty acid synthesis in various biological processes. This antibody specifically targets and neutralizes proteins involved in the synthesis of fatty acids, such as TNF-α, interleukin-6, and chemokines.</p>IgM Isotype Control Fc fusion protein (biotin)
<p>Rat monoclonal IgM Isotype Control Fc fusion protein (biotin)</p>Pureza:Min. 95%RAD1 antibody
<p>RAD1 antibody was raised in rabbit using the middle region of RAD1 as the immunogen</p>Pureza:Min. 95%RHOB Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHOB antibody, catalog no. 70R-4030</p>Pureza:Min. 95%ASB8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASB8 antibody, catalog no. 70R-5837</p>Pureza:Min. 95%REG3A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of REG3A antibody, catalog no. 70R-9069</p>Pureza:Min. 95%ADK antibody
<p>ADK antibody was raised in mouse using recombinant human ADK (22-362aa) purified from E. coli</p>CX40.1 antibody
<p>CX40.1 antibody was raised using the C terminal of CX40.1 corresponding to a region with amino acids QPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSG</p>Troponin T Type 1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT1 antibody, catalog no. 70R-2585</p>Pureza:Min. 95%G6PD protein
<p>1-491 amino acids: MAVTQTAQAC DLVIFGAKGD LARRKLLPSL YQLEKAGQLN PDTRIIGVGR ADWDKAAYTK VVREALETFM KETIDEGLWD TLSARLDFCN LDVNDTAAFS RLGAMLDQKN RITINYFAMP PSTFGAICKG LGEAKLNAKP ARVVMEKPLG TSLATSQEIN DQVGEYFEEC QVYRIDHYLG KETVLNLLAL RFANSLFVNN WDNRTIDHVE ITVAEEVGIE GRWGYFDKAG QMRDMIQNHL LQILCMIAMS PPSDLSADSI RDEKVKVLKS LRRIDRSNVR EKTVRGQYTA GFAQGKKVPG YLEEEGANKS SNTETFVAIR VDIDNWRWAG VPFYLRTGKR LPTKCSEVVV YFKTPELNLF KESWQDLPQN KLTIRLQPDE GVDIQVLNKV PGLDHKHNLQ ITKLDLSYSE TFNQTHLADA YERLLLETMR GIQALFVRRD EVEEAWKWVD SITEAWAMDN DAPKPYQAGT WGPVASVAMI TRDGRSWNEF E</p>Pureza:Min. 95%C10ORF33 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf33 antibody, catalog no. 70R-3261</p>Pureza:Min. 95%PEX5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PEX5 antibody, catalog no. 70R-2342</p>Pureza:Min. 95%SOD antibody
The SOD antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic and multidrug antibody that targets lipoprotein lipase, albumin, retinoid, and other important molecules. This polyclonal antibody has been extensively studied and shown to have high affinity for its target molecules. It has been used in various research applications, including the detection of interleukin-6, collagen, and other proteins in human serum. Additionally, this monoclonal antibody has been compared to adalimumab and shown to be highly effective in inhibiting the activity of TNF-α. Its versatility and reliability make it an essential tool for researchers in the field of Life Sciences.FBP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBP1 antibody, catalog no. 70R-1222</p>Pureza:Min. 95%NCOR1 antibody
<p>NCOR1 antibody was raised in Mouse using a purified recombinant fragment of NCOR1(aa1-192) expressed in E. coli as the immunogen.</p>CRP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRP antibody, catalog no. 70R-4527</p>Pureza:Min. 95%PCK1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCK1 antibody, catalog no. 70R-2484</p>Pureza:Min. 95%PIWIL2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL2 antibody, catalog no. 70R-2277</p>Pureza:Min. 95%Prr16 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Prr16 antibody, catalog no. 70R-9461</p>Pureza:Min. 95%FBLN1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBLN1 antibody, catalog no. 70R-5356</p>Pureza:Min. 95%Streptavidin Poly-HRP20 Conjugate
<p>Streptavidin Poly-HRP20 Conjugate (diluted to 50ug/ml in stabilizer 85R-1028).</p>Pureza:Min. 95%EWSR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-4833Pureza:Min. 95%Sdc3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sdc3 antibody, catalog no. 70R-8670</p>Pureza:Min. 95%ZNF527 antibody
<p>ZNF527 antibody was raised in rabbit using the C terminal of ZNF527 as the immunogen</p>Pureza:Min. 95%
