Compuestos y reactivos bioquímicos

<p>Rabbit polyclonal PSMC2 antibody</p>

<p>Rabbit polyclonal CCL7 antibody (biotin)</p>

<p>PRR11 antibody was raised using the middle region of PRR11 corresponding to a region with amino acids PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF</p>

<p>The Heparan Sulphate Proteoglycan antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to heparan sulphate proteoglycans, which are complex molecules composed of sugar chains and proteins. These proteoglycans play important roles in various biological processes, including cell adhesion, growth factor signaling, and extracellular matrix organization.</p>

<p>The ESA antibody is a monoclonal antibody that specifically targets erythropoietin (EPO) and its receptor. It has been shown to have a high affinity for EPO and effectively inhibits the binding of EPO to its receptor. This antibody is commonly used in life sciences research to study the role of EPO in various biological processes.</p>

<p>RASSF8 antibody was raised in rabbit using the N terminal of RASSF8 as the immunogen</p>

<p>ACOT11 antibody was raised in mouse using recombinant human ACOT11 (19-250aa) purified from E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL7 antibody, catalog no. 70R-1164</p>

<p>Rabbit polyclonal CRGF antibody (HRP)</p>

<p>Rabbit polyclonal PLCB3 antibody</p>

<p>ARHGAP9 antibody was raised in Rabbit using Human ARHGAP9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RORA antibody, catalog no. 70R-1939</p>

<p>DBCO-dPEG®12-Carboxyfluorescein is a PEG compound containing a fluorescein dye used for tagging biomolecules, and serving as fluorescent probe for bioimaging applications.</p>

<p>The ANXA3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets pancreatic glucagon and annexin A2, making it a valuable tool for studying insulin secretion and regulation. This antibody can be used in various applications such as immunohistochemistry, immunofluorescence, and Western blotting. Its high specificity and affinity make it an ideal choice for detecting and quantifying these proteins in samples. Additionally, the ANXA3 antibody can be used to develop inhibitors or autoantibodies for therapeutic purposes or to study the role of insulin antibodies in human serum. With its versatility and reliability, this antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal RPL36AL antibody (FITC)</p>

<p>C14orf169 antibody was raised in mouse using recombinant Human Chromosome 14 Open Reading Frame 169 (C14Orf169)</p>

<p>The REST antibody is a monoclonal antibody that has various functions in the field of Life Sciences. It acts as a functional sweetener, natriuretic, and also targets TNF-α, glutamate, and insulin antibodies. This antibody is widely used in research related to rubisco, polyclonal antibodies, cryptosporidium, glycosylation, adalimumab, glycoprotein, and proteins. With its high specificity and affinity for its target molecules, the REST antibody is an essential tool for scientists and researchers in the field of Life Sciences.</p>

<p>Cystatin C antibody was raised in Rabbit using Human CST3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRRG1 antibody, catalog no. 70R-6810</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST3GAL3 antibody, catalog no. 70R-1833</p>

<p>DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANS</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>ITFG1 antibody was raised using the N terminal of ITFG1 corresponding to a region with amino acids TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP</p>

<p>Mouse monoclonal SPR antibody</p>

<p>Purified Polyclonal CDC40 antibody</p>

<p>The alpha Actinin antibody is a histidine-rich monoclonal antibody that specifically targets autoantibodies. It is commonly used in research and diagnostic applications to detect the presence of specific autoantibodies in biological samples. This antibody has high specificity and sensitivity, making it an ideal tool for studying autoimmune diseases and other related disorders.</p>

<p>Rabbit polyclonal JunD antibody (Ser255)</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>hCG antibody was raised in rabbit using hCG as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C21orf13 antibody, catalog no. 70R-1973</p>

<p>AP2A1 antibody was raised in Rabbit using Human AP2A1 as the immunogen</p>

<p>Purified Polyclonal Translin antibody</p>

<p>The SLO antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to soluble peptide antigens, enabling scientists to study various aspects of antigen-antibody reactions. The SLO antibody is produced through recombinant protein technology, where the gene encoding the antibody is inserted into an expression plasmid and expressed in host cells. The resulting antibody preparations are then purified and immobilized onto a microtiter plate for use in experiments. With its high specificity and sensitivity, the SLO antibody is an invaluable tool for researchers studying antigen detection and characterization in various biological systems.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DEFB4A antibody, catalog no. 70R-10006</p>

<p>BST2 antibody is a highly specific monoclonal antibody that targets the glycoprotein BST2, also known as bone marrow stromal antigen 2. This antibody is widely used in life sciences research and diagnostics to detect and study the expression of BST2 in various biological samples. The BST2 protein plays a crucial role in immune response regulation, cell adhesion, and viral infection. The monoclonal antibody recognizes a specific epitope on BST2 and can be used for applications such as Western blotting, immunohistochemistry, flow cytometry, and ELISA. It offers high sensitivity and specificity, enabling accurate detection and quantification of BST2 protein levels. Researchers rely on this reliable tool to investigate the role of BST2 in various physiological processes and diseases, including cancer, viral infections, and autoimmune disorders. With its exceptional performance and versatility, the BST2 antibody is an invaluable asset for scientists working in diverse fields of biology and medicine.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MSLN antibody, catalog no. 70R-6174</p>

<p>GUCA1A antibody was raised in Rabbit using Human GUCA1A as the immunogen</p>

<p>FXR2 Monoclonal Antibody</p>

<p>Purified recombinant Human FBL protein</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A1 antibody, catalog no. 70R-6761</p>

<p>HSV6 37EA antibody was raised in mouse using 37 KDa early antigen of HHV6 as the immunogen.</p>

<p>Deoxyribonuclease I Bovine is an enzyme extracted from pancreas, thymus, or bovine tissue culture. It may be used to digest proteins in order to remove damaged linkages and produce a soluble protein-free extract. Deoxyribonuclease I Bovine can also be used for the removal of DNA from cells, tissues, and organs for biochemical methods such as biochemical assays, immunoassays, and nucleic acid amplification.</p>

<p>Mouse monoclonal TNNI1 antibody</p>

<p>Rabbit polyclonal Src antibody (Tyr216)</p>

<p>TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL</p>

<p>THAP11 antibody was raised in Mouse using a purified recombinant fragment of human THAP11 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RIPX antibody, catalog no. 70R-8029</p>

<p>Mouse monoclonal SHPRH antibody</p>

<p>SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH</p>

<p>EGR1 antibody was raised in Mouse using a purified recombinant fragment of human EGR1(aa282-433) expressed in E. coli as the immunogen.</p>

<p>The MEF2A antibody is a monoclonal antibody that specifically targets the endogenous protein kinase MEF2A. This antibody can be used to detect and quantify the activation of MEF2A in various cell lines and tissues. It has been shown to have specific reactivity with the target molecule, making it a reliable tool for studying the function of MEF2A in cellular processes.</p>

<p>Rb antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the tnf-α antigen and has been shown to inhibit endothelial growth. This antibody binds to tyrosine residues on the target protein, mimicking the action of growth factor antibodies. In addition to its role in angiogenesis, Rb antibody can also be used in nuclear studies to detect and quantify specific proteins using techniques such as polymerase chain reaction (PCR). Polyclonal Antibodies are also available for this target, providing researchers with a range of options for their experiments.</p>

<p>The PDIA3 antibody is a polyclonal antibody that is highly effective in targeting cytotoxic cells. It specifically binds to annexin, a protein expressed on the surface of cytotoxic cells, allowing for precise and accurate targeting. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in the treatment of various diseases. It has been found to be particularly effective against autoantibodies and antiviral agents. Additionally, the PDIA3 antibody has shown potential in targeting circumsporozoite protein, making it a valuable tool in vaccine development. With its high specificity and affinity, this antibody is an essential component of any research or diagnostic laboratory.</p>

<p>RBM9 antibody was raised using the N terminal of RBM9 corresponding to a region with amino acids GSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKR</p>

<p>Mouse monoclonal RIT2 antibody</p>

<p>Rabbit polyclonal AML1 antibody (Ser276)</p>

<p>BCL10 antibody was raised in Mouse using a purified recombinant fragment of human BCL-10 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal CD2BP2 antibody</p>

<p>Mouse monoclonal SPR antibody</p>

<p>CLGN antibody was raised in Rabbit using Human CLGN as the immunogen</p>

<p>Mouse monoclonal PHF21B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OGT antibody, catalog no. 70R-2046</p>

<p>EIF2B1 antibody was raised in Rabbit using Human EIF2B1 as the immunogen</p>

<p>The PLS3 antibody is a highly specialized polyclonal antibody that targets the transferrin receptor in cells. This antibody has been extensively studied and proven to have cytotoxic effects on cancer cells. It specifically recognizes the nuclear antigen, hemagglutinin, and has been shown to inhibit exocytosis in cells. The PLS3 antibody also plays a role in glycosylation processes and has been found to modulate interleukin-6 signaling pathways. This monoclonal antibody is an invaluable tool for researchers studying cell antigens and tyrosine-related processes. With its high specificity and potency, the PLS3 antibody is a crucial component of any immunological research project.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT17 antibody, catalog no. 70R-2133</p>

<p>Rabbit polyclonal GPR85 antibody</p>

<p>hCG_1646157 antibody was raised in rabbit using the middle region of HCG_1646157 as the immunogen</p>

<p>PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW</p>

<p>Goat anti-mouse IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using murine IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal P2RY13 antibody</p>

<p>Rabbit polyclonal UBXN6 antibody</p>

<p>ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL</p>

<p>Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLDN antibody, catalog no. 70R-2857</p>

<p>Purified Polyclonal Claudin 11 antibody</p>

<p>The CRYAB antibody is a highly specific monoclonal antibody that is used in various applications in the field of Life Sciences. This antibody is designed to target and bind to CRYAB, a protein that plays a crucial role in cellular processes. It has been widely used in research studies to investigate the function of CRYAB and its potential involvement in various diseases.</p>

<p>Mouse monoclonal CMBL antibody</p>

<p>DLK1 antibody was raised in Rabbit using Human DLK1 as the immunogen</p>

<p>Purified Rabbit polyclonal Lamin A antibody (Ser22)</p>

<p>HMR 1098 is a κ-opioid receptor agonist that has shown to have the ability to protect against myocardial infarct in anesthetized animals and to increase ATP levels. This drug also has metabolic effects, as it can improve mitochondrial function and prevent mitochondrial membrane potential from being reduced by oxidative stress. HMR 1098 also prevents the activation of atp-sensitive K+ channels in ventricular myocardium, which leads to an increase in cardiac contractility and improved heart rate. This drug has been shown to be effective in vivo, as it was able to reduce infarct size in a rat model of myocardial infarct.</p>

<p>ST14 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT</p>

<p>Rabbit polyclonal CTAK1 antibody</p>

<p>Mouse monoclonal LSM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BPNT1 antibody, catalog no. 70R-3134</p>

<p>ALY/Ref Monoclonal Antibody (FITC)</p>

<p>EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen</p>

<p>BSG antibody was raised in rabbit using the N terminal of BSG as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCLRE1C antibody, catalog no. 70R-2290</p>

<p>Affinity purified Mouse polyclonal Connexin 32 antibody</p>

<p>C7ORF29 antibody was raised using the middle region of C7Orf29 corresponding to a region with amino acids VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH</p>

<p>The Histone H3 antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to Histone H3, a protein involved in DNA packaging and gene regulation. This antibody has been extensively validated for its high specificity and sensitivity in detecting Histone H3 modifications, such as acetylation.</p>

<p>Rabbit Polyclonal PKC mu antibody (Ser738)</p>

<p>Mouse monoclonal AK5 antibody</p>

<p>CD46 antibody was raised in Rabbit using Human CD46 as the immunogen</p>

<p>The SERCA1 antibody is an active agent that is commonly used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to SERCA1, a low-density protein found in various cells including MCF-7 cells. This antibody is often used in research studies to investigate the role of SERCA1 in different cellular processes.</p>

<p>Purified Guinea Pig IgG (Fab) HRP conjugate</p>

<p>4-N,N-Bis(4-methylphenyl)-amino-benzaldehyde-N,N-diphenylhydrazone is a research tool and can be used to study interactions of ligands with receptors. This chemical is also an activator that stimulates ion channels in cells, which can lead to a change in the membrane potential. It has been shown to be a potent inhibitor of protein interactions that are mediated by peptides. 4-N,N-Bis(4-methylphenyl)-amino-benzaldehyde-N,N-diphenylhydrazone also has high purity and is suitable for use in cell biology and pharmacology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS29 antibody, catalog no. 70R-1428</p>

<p>ApoE antibody was raised in mouse using human apolipoprotein E as the immunogen.</p>