Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC645015 antibody, catalog no. 70R-2855</p>

<p>DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS</p>

<p>LRRC8D antibody was raised in Rabbit using Human LRRC8D as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VASH1 antibody, catalog no. 70R-2056</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, making it highly efficient in treating tuberculosis infections. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED</p>

<p>WBP4 antibody was raised in rabbit using the N terminal of WBP4 as the immunogen</p>

<p>Rabbit Polyclonal VASP antibody (Ser238)</p>

<p>The EMR2 antibody is a highly specific monoclonal antibody that targets the EMR2 antigen. This antigen plays a crucial role in various cellular processes, including interleukin-6 signaling, antibody-drug conjugate internalization, nuclear localization, glycosylation, phosphatase activity regulation, and exocytosis.</p>

<p>The ASNS antibody is a monoclonal antibody that specifically targets the asparagine synthetase (ASNS) protein. This protein plays a crucial role in cellular growth and metabolism by catalyzing the conversion of aspartate to asparagine. The ASNS antibody can be used in various research applications, including immunoassays, Western blotting, and immunohistochemistry.</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser939)</p>

<p>Rabbit Polyclonal Elk1 antibody (Ser389)</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>Mouse monoclonal GBA3 antibody</p>

<p>MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI</p>

<p>C1qtnf2 antibody was raised in rabbit using the middle region of C1qtnf2 as the immunogen</p>

<p>Goat RBC antibody was raised in rabbit using goat erythrocytes as the immunogen.</p>

<p>The HSP90 alpha antibody is a cytotoxic agent that targets the heat shock protein 90 (HSP90) alpha isoform. This antibody specifically binds to HSP90 alpha, inhibiting its function and preventing the proper folding and stabilization of client proteins. HSP90 is involved in various cellular processes, including the folding and maturation of proteins such as erythropoietin and fibronectin. By blocking HSP90 alpha, this antibody disrupts these processes, leading to cellular dysfunction and ultimately cell death.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>CDC2L6 antibody was raised in Rabbit using Human CDC2L6 as the immunogen</p>

<p>SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTV</p>

<p>Mouse monoclonal PGR antibody (Ser190)</p>

<p>TACR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The Parkin antibody is a peptide agent that belongs to the group of polyclonal antibodies. It is widely used in life sciences research for its ability to detect and quantify parkin protein levels. Parkin is an important regulator of cellular processes, including erythropoietin production, growth factor signaling, and inhibition of alpha-fetoprotein expression. This antibody has been extensively validated for its specificity and sensitivity in various assays, making it a valuable tool for researchers studying parkin-related pathways. Additionally, the Parkin antibody has been shown to have neutralizing effects on angiotensin-converting enzyme activity and collagen synthesis in cardiomyocytes. Its pegylated form further enhances its stability and efficacy in experimental settings. Choose the Parkin antibody for reliable results in your research endeavors.</p>

<p>SOHLH1 antibody was raised using the middle region of SOHLH1 corresponding to a region with amino acids EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT</p>

<p>The ARNT2 antibody is a highly specialized antibody that is used in various assays and research studies in the field of Life Sciences. This antibody specifically targets and binds to ARNT2, which is a protein involved in various cellular processes. The ARNT2 antibody can be used for applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>HADHB antibody was raised using a synthetic peptide corresponding to a region with amino acids LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE</p>

<p>PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL2 antibody, catalog no. 70R-4468</p>

<p>Rabbit Polyclonal Src antibody (Tyr418)</p>

<p>MCM10 antibody was raised in Rabbit using Human MCM10 as the immunogen</p>

<p>HSD3B2 antibody was raised using the N terminal of HSD3B2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN</p>

<p>Region of RANK protein corresponding to amino acids PAMMEGSWLD VARRGKPEAQ PFAHLTINAA DIPSGSHKVS LSSWYHDRGW AKISNMTLSN GKLRVNQDGF YYLYANICFR HHETSGSVPA DYLQLMVYVV KTSIKIPSSH NLMKGGSTKN WSGNSEFHFY SINVGGFFKL RAGEEISVQV SNPSLLDPDQ DATYFGAFKV QDID.</p>

<p>N-Desmethyl-N-cyclopentyl tadalafil is an inhibitor of cyclic nucleotide phosphodiesterase (PDE) 5. It inhibits the breakdown of cGMP, which promotes vasodilation and erectile function by increasing blood flow to the penis. N-Desmethyl-N-cyclopentyl tadalafil has been shown to be a potent inhibitor of PDE5 with IC50 values in the low nanomolar range.</p>

<p>CD45 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit Polyclonal PLSCR4 antibody</p>

<p>Rat monoclonal NKG2D antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF780B antibody, catalog no. 70R-8873</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC74A antibody, catalog no. 70R-4386</p>

<p>Rabbit polyclonal IP3R1 antibody (Ser1764)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LANCL3 antibody, catalog no. 70R-9359</p>

<p>Rabbit polyclonal PSMB7 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERINC2 antibody, catalog no. 70R-9351</p>

<p>Rabbit polyclonal TRIM15 antibody</p>

<p>Mouse monoclonal InfIuenza A Virus Nucleoprotein antibody</p>

<p>Rabbit polyclonal AGFG2 antibody</p>

<p>NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD</p>

<p>Calpastatin antibody was raised in mouse using bovine skeletal muscle calpastatin as the immunogen.</p>

<p>GSK3 alpha antibody was raised in Mouse using a purified recombinant fragment of GSK3 alpha expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal EMR4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VARS antibody, catalog no. 70R-3182</p>

<p>Rabbit Polyclonal OR5F1 antibody</p>

<p>GABRD antibody was raised in rabbit using the N terminal of GABRD as the immunogen</p>

<p>MYL3 antibody was raised in Rabbit using Human MYL3 as the immunogen</p>

<p>KIF25 antibody was raised in rabbit using the N terminal of KIF25 as the immunogen</p>

<p>Dnaja1 antibody was raised in rabbit using the N terminal of Dnaja1 as the immunogen</p>

<p>Rabbit polyclonal APC1 antibody (Ser688)</p>

<p>Amodiaquine Hydrochloride (USP grade powder) chemical reference substance</p>

<p>KIF2C antibody was raised using the N terminal of KIF2C corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT</p>

<p>Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.</p>

<p>Rabbit polyclonal PITX2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALT6 antibody, catalog no. 70R-7452</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections due to its bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high potency has been demonstrated through the patch-clamp technique on human erythrocytes. In addition, it undergoes various metabolic transformations such as hydrolysis, oxidation, reduction, and conjugation. Rifapentine specifically targets markers expressed in Mycobacterium tuberculosis strains and hinders their growth in culture.</p>

<p>Rabbit polyclonal PDGFR beta antibody (Tyr1021)</p>

<p>The STAT5A antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to STAT5A, a protein involved in various cellular processes. This monoclonal antibody has been extensively tested and proven to have high specificity and sensitivity.</p>

<p>Purified recombinant E.coli mdh Protein (His tag)</p>

<p>CHI3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL</p>

<p>CD94 antibody was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.</p>

<p>The TYRO3 antibody is a monoclonal antibody that has neutralizing properties against interferon (IFN). It is used as an inhibitor to block the activity of IFN and its downstream effects. This antibody specifically targets the TYRO3 receptor, which is involved in the signaling pathway of IFN. By blocking this receptor, the TYRO3 antibody prevents the activation of downstream pathways that are mediated by IFN.</p>

<p>1225-1456 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSVAHL HAPTGSGKST KVPAAYAAQG YKVLVLNPSV AATLGFGAYM SKAHGVDPNI RTGVRTITTG SPITYSTYGK FLADGGCSGG AYDIIICDEC HSTDATSILG IGTVLDQAET AGARLVVLAT ATPPGSVTVS HPNIEEVALS TTGEIPFYGK AIPLEVIKGG RHLIFCHSKK KCDELAAKLV ALGINAVAYY RGLDVSVIPT SGDVVVVSTD ALMTGFTGDF DSVIDCNT</p>

<p>MAGED2 antibody was raised in Rabbit using Human MAGED2 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Purified recombinant IGLL1 protein (His tag)</p>

<p>Rabbit polyclonal CDPK13 antibody</p>

<p>The Androgen Receptor antibody is a powerful tool used in Life Sciences research. It is available as both Polyclonal Antibodies and Monoclonal Antibodies, providing researchers with options to suit their specific needs. This antibody targets the Androgen Receptor, a protein that plays a crucial role in steroid signaling and growth factor regulation.</p>

<p>Rabbit polyclonal SLC38A1 antibody</p>

<p>DGKH antibody was raised in Rabbit using Human DGKH as the immunogen</p>

<p>Purified recombinant Human PHPT1 protein</p>

<p>ZNF93 antibody was raised in rabbit using the N terminal of ZNF93 as the immunogen</p>

<p>Affinity purified Sheep polyclonal Sheep anti Bovine IgG1 antibody</p>

<p>IRF7 antibody was raised in mouse using recombinant human IRF-7 (1-150aa) purified from E. coli as the immunogen.</p>

<p>CD5l protein is a pluripotent stem cell-derived protein that plays a crucial role in various biological processes. It has been shown to have therapeutic potential in the treatment of choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. CD5l protein can neutralize the activity of certain growth factors involved in this process, thereby inhibiting the formation of new blood vessels.</p>

<p>Rat monoclonal IL4 antibody (PE)</p>

<p>Purified Polyclonal GAD1 antibody</p>

<p>Rabbit polyclonal OR10G9 antibody</p>

<p>The ERCC1 antibody is a polyclonal antibody that has been developed for use in life sciences research. It is used to detect and measure the expression of ERCC1, a protein involved in DNA repair and maintenance. This antibody has been shown to have inhibitory properties against neurotrophic factors, TGF-β1, insulin, and chemokines. It can also neutralize the activity of interferons and other activated proteins. The ERCC1 antibody is commonly used in immunoassays and can be used to study various cellular processes such as collagen synthesis, protein kinase activity, and the effects of nuclear inhibitors.</p>

<p>Purified Polyclonal GLRB antibody</p>

<p>Purified recombinant Human HRSP12 protein</p>

<p>MYST2 antibody was raised in Rabbit using Human MYST2 as the immunogen</p>

<p>Purified recombinant Human RALB protein</p>

<p>Rabbit polyclonal CD44 antibody (Ser706)</p>

<p>Rabbit polyclonal DUS4 antibody</p>

<p>Mouse monoclonal PIH1D2 antibody</p>

<p>Rabbit polyclonal GPR63 antibody</p>

<p>LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen</p>

<p>HEF1/NEDD-9 Monoclonal Antibody</p>

<p>WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF652 antibody, catalog no. 70R-7878</p>

<p>CDK6 antibody was raised in Rabbit using Human CDK6 as the immunogen</p>

<p>Transportin 1/MIP Monoclonal Antibody BSA/Azide Free</p>