Compuestos y reactivos bioquímicos

<p>Inhibitor of protein phosphatase PPM1D/PP2CÎŽ/WIP1</p>

<p>UNC2541 is an autophagy inhibitor that binds to the bromodomain and inhibits tyrosine kinase activity. It has been shown to have cancer cell death properties. UNC2541 inhibits receptor tyrosine kinase, which is a primary target in pediatric cancers. This inhibitor also binds to the receptor tyrosine kinase domain and blocks the phosphorylation of intracellular proteins, leading to inhibition of tumor growth.</p>

<p>SPI-112Me is an analog of interferon-alfa-2b (IFN-α). It has been shown to be activated by dephosphorylation and to bind to the epidermal growth factor receptor (EGFR) with high affinity. SPI-112Me inhibits the phosphatase activity of EGFR, leading to decreased cellular uptake and activation of the cell cycle. SPI-112Me also inhibits tumor xenografts in transgenic animals and reduces cancer cell proliferation in vivo. This compound has been found to inhibit the binding of a number of inhibitors to their targets.</p>

<p>GDC046 is a triazole compound with inhibitory properties that acts as a tyrosine kinase inhibitor. It binds to the active site of the enzyme and prevents ATP from binding, inhibiting the enzyme's activity. GDC046 has shown efficacy in vitro against several cancer cell lines and has been found to be safe in vivo. GDC046 has also been found to be selective for the target enzyme, which minimizes off-target effects.</p>

<p>Chidamide is an inhibitor of histone deacetylases (HDACs) that belongs to the drug therapy groups. It induces apoptosis by increasing the expression of Bcl-2 protein and decreasing the expression of Bax protein in squamous cell carcinoma cells. Chidamide also has a significant cytotoxicity, which is caused by its ability to inhibit HDACs and induce apoptosis. Combination therapy with nonsteroidal anti-inflammatory drugs and other drugs may have a synergistic effect on cancer treatment.</p>

<p>ICI-118551 Hydrochloride is a drug that binds to the β-adrenergic receptor, which may be an important therapeutic target for the treatment of depression. ICI-118551 Hydrochloride has been shown to have positive effects in vivo in animal studies, and also stabilizes cancer cells. ICI-118551 Hydrochloride is a potent agonist at β-adrenergic receptors with a high affinity for these receptors. It has been found to be efficacious in assays measuring receptor binding and activity, and it also binds selectively to β-adrenergic receptors.<br>ICI-118551 Hydrochloride is not active against primary tumours, but it does show anti-cancer effects. This drug stabilizes cancer cells by inhibiting the activation of G proteins downstream of the β adrenoceptor.</p>

<p>PD 176252 is a cytosolic calcium ionophore that has been shown to enhance the cytotoxicity of cisplatin in cancer cells. It binds to cyclic adenosine monophosphate (cAMP) and increases intracellular calcium concentrations by opening the channels of R-type voltage dependent calcium channels. PD 176252 also inhibits epidermal growth factor receptor tyrosine kinase activity, which may contribute its anti-cancer effects. The molecular modeling study showed that PD 176252 binds to the peptide binding site on metalloproteases by hydrogen bonding with the backbone amide group of Asp residues, which are often found in this region. This drug does not inhibit proteolysis, but blocks the catalytic domain of metalloproteases from binding to substrates.</p>

<p>16:0 Cyanur pe is a synthetic phospholipid compound, which is derived from saturated fatty acids. This substance is primarily utilized in the field of lipidomics as a part of phospholipid membrane studies. With its unique structure, it facilitates the exploration of lipid interactions within biological membranes and can serve as a probe in biophysical experiments.</p>

<p>Metabolite of ranolazine</p>

<p>GQ-16 is a synthetic photoinitiator, which is typically derived from advanced chemical synthesis processes involving aromatic ketones or similar compounds. Its primary mode of action involves the absorption of ultraviolet (UV) light to generate free radicals. These radicals then initiate polymerization by opening the double bonds in monomers, leading to the formation of polymers.</p>

<p>Diproqualone is a quinazolinone compound that is used in the treatment of cancer. It has potent inhibition effects against human leukemias and, as an active substance, can be found in pharmaceutical preparations. The prognosis for treatment with this drug is determined by the binding constants of diproqualone to specific sites on DNA and protein molecules. Turbidimetric methods have been used for diagnosis in humans.</p>

<p>4-Hydroxychrysene is a hydrocarbon that is found in coal tar and petroleum products. It has been shown to be a carcinogen in animals, causing lung cancer when inhaled. 4-Hydroxychrysene also causes DNA damage, chromosomal aberrations, as well as mutations. The aromatic ring of the molecule is susceptible to hydroxylation, leading to the formation of other compounds such as 2-hydroxychrysene and 3-hydroxychrysene. These compounds are also known to be carcinogenic. 4-Hydroxychrysene can also cause tumors in rats by forming adducts with DNA and proteins. 4-Hydroxychrysene emissions have been shown to cause DNA damage in cells from rat liver microsomes and mammalian cells.</p>

<p>γ6 Tm1A Trifluoroacetate is a potent inhibitor of the acetylcholinesterase enzyme, which degrades the neurotransmitter acetylcholine. It has been shown to have high purity and is suitable for research purposes. γ6 Tm1A Trifluoroacetate binds to the active site of acetylcholinesterase, blocking the access of acetylcholine and preventing its degradation, leading to an accumulation of acetylcholine at synapses in the brain. This leads to increased transmission across synapses and higher levels of excitation in neurons.</p>

<p>NVP-BEP800 is a small molecule inhibitor, which is a synthetic compound designed to target specific proteins. This product is developed by Novartis and falls under the category of Hsp90 inhibitors. Hsp90, or Heat Shock Protein 90, is a molecular chaperone involved in the proper folding, stability, and function of many client proteins, many of which are implicated in cancer progression. NVP-BEP800 binds to the ATP-binding site of Hsp90, thereby inhibiting its chaperone activity.</p>

<p>Bix-02188 is a small molecule that inhibits protein synthesis by inhibiting the activity of the transcription-polymerase chain. Bix-02188 has been shown to have a protective effect on diabetic mice with chronic kidney disease. It also protects against renal damage caused by high salt and cancer, as well as lung damage caused by radical prostatectomy. The drug has been shown to inhibit the growth of cancer cells in culture and to reduce symptoms in patients with epidermal growth factor receptor mutations. Bix-02188 may also be used for the treatment of other diseases associated with uncontrolled cell proliferation, such as psoriasis and Alzheimer's disease.</p>

<p>VER 49009 is a chaperone that binds to the amide group of proteins, inhibiting their function. VER 49009 has been shown to inhibit cancer cells in vitro and in vivo by preventing protein synthesis. This compound also inhibits the production of heat-shock proteins. It can be used for the treatment of cancer, as well as other diseases associated with high levels of heat-shock proteins, such as pediatric cancer.</p>

<p>Antagonist of cannabinoid receptor CB1</p>

<p>GR148672X is a peptide that has been shown to inhibit the interaction between the NMDA receptor and its ligand, glutamate. GR148672X binds to the NMDA receptor and prevents the binding of glutamate, thereby preventing the activation of the receptor. This drug is being developed as a research tool for studying protein interactions and may also be used in treating pain associated with nerve damage. GR148672X is a high purity peptide at 99% purity by HPLC analysis.</p>

<p>Please enquire for more information about HS 014 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mcl1-IN-2 is a recombinant human Mcl-1 inhibitor peptide. Mcl-1 is a proapoptotic protein that regulates cell death and survival signaling pathways. This recombinant peptide can be used as a research tool to study the regulation of apoptosis by Mcl-1. The peptide has been shown to inhibit the activation of caspases, which are enzymes that play an important role in the execution phase of apoptosis.</p>

<p>Sting agonist-3 is a cytotoxic agent that binds to extracellular nucleic acid. It is used in the treatment of systemic inflammation, such as sepsis and chronic obstructive pulmonary disease. Sting agonist-3 has been shown to modulate the immune response by increasing the production of myeloid cells, which are important for fighting infections. This agent also inhibits tumor growth by inducing apoptosis and inhibiting tumor cell proliferation. Sting agonist-3 has been shown to be an anticancer drug with anti-cancer activity in animal models that may be due to its ability to inhibit cancer cell proliferation and induce apoptosis.</p>

<p>Caldaret is an analog of the natural hormone calcitonin, which has a number of biological effects. Caldaret is used for the treatment of osteoporosis, but it can also be used to treat bowel disease. Caldaret works by inhibiting the activity of enzymes that break down or destroy cytosolic calcium (Ca2+). It has been shown to reduce symptoms of inflammatory bowel disease, such as abdominal pain and diarrhea, in animal models and humans. Caldaret may be administered as a low-dose group with degarelix acetate for prostate cancer therapy. This combination therapy may be effective in preventing the recurrence of cancer cells due to its ability to inhibit cardiac ryanodine receptor and Ca2+ overload in heart tissue.</p>

<p>MKC-3946 is a small molecule drug that inhibits cellular protein synthesis by binding to the endoplasmic reticulum (ER) and blocking the action of cellular proteins. It has been shown to be effective in treating pancreatitis in rats, as well as cancer in mice. MKC-3946 is an inhibitor of pro-apoptotic protein that causes apoptosis by binding to the polymerase chain reaction (PCR) enzyme, thereby preventing transcription and replication. The effective dose for MKC-3946 is between 10 mg/kg and 100 mg/kg.</p>

<p>ML224 is a ryanodine receptor antagonist that has been shown to be effective in the treatment of cardiac disease. ML224 is a selective, competitive antagonist of the ryanodine receptor. It blocks calcium release from the sarcoplasmic reticulum, which leads to decreased intracellular calcium concentrations and reduced contractility. This drug has also been shown to have anti-inflammatory properties by inhibiting IL-10 production. ML224 has also been shown to inhibit acetylcholinesterase activity, leading to increased acetylcholine levels at synapses in the central and peripheral nervous systems. This may contribute to its ability to increase blood pressure and heart rate.</p>

<p>Phen-dc3 trifluoromethanesulfonate is a molecule that binds to RNA and inhibits the replication of RNA. It has high binding constants and strong sequence specificity, and it is able to form stable complexes with both double-stranded and single-stranded RNA. Phen-dc3 trifluoromethanesulfonate inhibits cancer cell growth by blocking the production of messenger RNA (mRNA) in cancer cells. This molecule also binds to the protein cell factor, which is involved in cellular proliferation, apoptosis, and differentiation. Phen-dc3 trifluoromethanesulfonate has been shown to inhibit autophagy, which leads to tumour suppression. Phen-dc3 trifluoromethanesulfonate is a chemical compound that can be used for studying the molecular biology of cancer cells.</p>

<p>3-[[2-(Cyclopentylamino)-3,4-dioxo-1-cyclobuten-1-yl]amino]-2-hydroxy-N-methylbenzamide is a potent enzyme inhibitor, which is synthetically derived with high specificity for certain protein interactions. Its mode of action involves the inhibition of targeted enzymatic activity, potentially modulating biochemical pathways of interest in various scientific studies.</p>

<p>BC-LI-0186 is a microbial inoculant, which is a blend of beneficial microbes derived from natural soil environments with symbiotic relationships with plants. The mode of action involves colonization of the rhizosphere and the enhancement of nutrient uptake by solubilizing phosphates and fixing atmospheric nitrogen. Additionally, it facilitates the production of growth-promoting substances such as auxins and cytokinins.</p>

<p>CPI-637 is a potential drug for the treatment of prostate cancer. It is a small molecule that binds to the bromodomain, which is an important cellular protein that regulates transcriptional regulation. Bromodomains are found in many proteins and are known to be involved in many cellular processes and cancers. CPI-637 has been shown to inhibit the expression of genes associated with prostate cancer, HIV infection, and carcinogenesis. This agent does not bind to DNA but binds to histone h3 at a specific site called the response element-binding protein (RBP), which inhibits gene expression by binding to the RBP.</p>

<p>Bax inhibitor peptide V5 is a growth factor that inhibits the activity of bax. It is an acidic molecule that binds to cancer tissues and prostate cancer cells, and can be used for the treatment of these cancers. Bax inhibitor peptide V5 has been shown to have radiosensitizing effects in colorectal carcinoma cells. This growth factor also inhibits protease activity, which may be useful in treating cancer cells. Bax inhibitor peptide V5 has been shown to inhibit protein synthesis in cell culture studies and can cause apoptosis in cancer cells.</p>

<p>The gw 1929 hydrochloride is an activator of prophylaxis. The gw 1929 hydrochloride is used for the prophylactic, and/or therapeutic treatment of bacterial infections. It can be used in prophylactic applications for prevention of bacterial infection, or in therapeutic applications for treatment of a bacterial infection. The gw 1929 hydrochloride can be used to treat infections caused by bacteria such as Staphylococcus aureus, Streptococcus pneumoniae, Haemophilus influenzae, Escherichia coli, Mycoplasma pneumoniae, and Listeria monocytogenes.</p>

<p>(2Z)-2-(8-Methoxy-6-thiatricyclo[8.4.0.03,7]tetradeca-1(14),3(7),4,8,10,12-hexaen-2-ylidene)acetic acid is a synthetic small molecule, designed as a specialized compound for targeting specific biochemical pathways. It is derived through precision chemical synthesis, ensuring high purity and efficacy. The compound acts by modulating certain receptor activities, altering signal transduction mechanisms at a cellular level. This modulation may influence various biological processes, making it a candidate for research in therapeutic applications.</p>

<p>SAR-260301 is a small molecule that inhibits the activation of epidermal growth factor receptor (EGFR), which is a tyrosine kinase receptor. SAR-260301 prevents the phosphorylation of the EGFR, which blocks the downstream signaling pathways and inhibits tumor cell proliferation. SAR-260301 has been shown to be effective in cancer treatment by inhibiting tumor cell proliferation and stimulating apoptosis, as well as reducing oxidative injury. It also selectively inhibits EGFR over other kinases such as insulin receptor and platelet-derived growth factor receptor. SAR-260301 has not yet been tested on human subjects but has demonstrated promising results in animal models with skin cancer or cervical cancer.</p>

<p>Lesinurad sodium is a prodrug that is hydrolyzed to form ethyl formate, which inhibits the acid transporter (NT) in the kidneys. It is used for the treatment of chronic gouty arthritis and hyperuricemia associated with the use of xanthine oxidase inhibitors or allopurinol. Lesinurad sodium has been shown to be effective in reducing serum uric acid levels and pain symptoms in patients with chronic gouty arthritis. The drug has a plasma concentration-time curve that follows first-order kinetics and an elimination half-life of 15 hours. Lesinurad sodium has been shown to inhibit NT activity by structural formula, reaction yield, introducing techniques, and pharmacodynamics.</p>

Asmi is a biomarker that may be used for the diagnosis of bowel disease. It is a monoclonal antibody that binds to the protein albumin, which is found in the blood, and has been shown to be associated with congestive heart failure (CHF) and inflammatory bowel disease. Asmi has also been shown to have high sensitivity and specificity for detecting inflammation in patients with Crohn's disease. The levels of Asmi were found to be higher in patients with active Crohn's disease than in those with inactive Crohn's disease or healthy controls. This biomarker could be used as a measure of disease activity, which can help physicians manage their patient's condition.

<p>Arjunglucoside I is a compound that belongs to the group of triterpenoid saponins. It has been shown to have anti-inflammatory, anticarcinogenic and anti-mutagenic properties in experimental models. Arjunglucoside I inhibits inflammatory bowel disease by regulating the immune response of T-cells and natural killer cells. The compound also has beneficial effects on skin conditions such as eczema and psoriasis, as well as collagen production in skin fibroblasts. Arjunglucoside I can be found in food products such as cereal grains, wheat, oats and rye.</p>

<p>Proprotein convertase subtilisin kexin type 9 (PCSK9) inhibitor</p>

<p>Inhibits BRAF proto-oncogene mutant V600E</p>

<p>Azd-8529 mesylate is a novel ion channel activator that has been shown to activate the TRPV1 receptor, which is involved in pain sensation. It has also been shown to inhibit the activity of potassium channels. Azd-8529 mesylate is an excellent research tool for studying protein interactions and can be used in the study of cell biology, including activation or inhibition of cells.</p>

<p>18:1 Dansyl ps is a fluorescent lipid probe, which is a synthetic derivative of phosphatidylserine. It is labeled with a dansyl group, providing unique fluorescent properties. This product is sourced from synthetic lipid modification processes, allowing for precise incorporation of the fluorescent moiety into the lipid structure. The mode of action of 18:1 Dansyl ps involves its integration into lipid bilayers, where its fluorescent properties can be used to investigate membrane dynamics, interactions, and organization.</p>

<p>Sod1 is a member of the superoxide dismutase family. Sod1 is an activator of the mitochondrial membrane enzyme complex I, which catalyzes the conversion of NADH to NAD. Sod1 has been shown to be a ligand for the nicotinic acetylcholine receptor and has been shown to activate these receptors in a calcium-dependent manner. It also interacts with ion channels and phospholipase C. Sod1 may be used as a research tool for cell biology, pharmacology, or protein interactions.</p>

<p>GFB-8438 is a molecule that is structurally similar to the non-selective cation channel blocker, amiloride. GFB-8438 blocks the uptake of ions from the cytoplasm into organelles and may be useful in treating virus infections and cancers. It has been shown to inhibit coronaviruses and other viruses that use ion channels for cellular entry. GFB-8438 also inhibits cation channels in cells, which are important for cell function, highlighting its potential as a cancer drug.</p>

<p>CIL62 is a molecule that has been shown to induce ferroptosis, a form of programmed cell death. Ferroptosis is triggered by oxidative stress and characterized by the formation of lipid-rich, iron-containing organelles called lipidosomes. CIL62 induces ferroptosis by inhibiting the activity of the protein caspase-8, which is an enzyme that activates other caspases. CIL62 also inhibits the activity of caspase-9 and -3, two proteins involved in apoptosis, or programmed cell death.</p>

<p>PD128907 HCl is a dopamine D3 receptor antagonist. It has been shown to have an inhibitory effect on the neurotransmitter dopamine, which is responsible for regulating mood, movement, and cognition. PD128907 HCl is a non-selective antagonist that can bind to both dopamine D1 and D2 receptors as well as serotonin 5-HT2A receptors. This drug has been tested in animal models of hyperactivity, and it has been shown to reduce symptoms of this condition by blocking the dopamine D4 receptor.</p>

<p>[Pyr1]apelin-13 (human) (CAS: 217082-60-5)</p>

<p>2-Aminoacridone is a fluorescent chemical that can be used to detect the presence of α1-acid glycoprotein in human serum. 2-Aminoacridone is used as an analytical tool for measuring the activity of enzymes that catalyze nucleic acid synthesis, such as polymerases and transcription factors. It is also used to measure the activity of enzymes involved in polysaccharide synthesis, such as glycosyltransferases and glucuronidases. This chemical reacts with basic fibroblast cells and macrophages, which are white blood cells that play a role in inflammation. 2-Aminoacridone is also effective at detecting the presence of acidic oligosaccharides in polymers. The fluorescence detector is used to measure the intensity of this reaction by measuring the emission spectrum. The enzyme substrates are added to provide energy for this reaction, while trifluoroacetic acid removes any water molecules that may interfere</p>

<p>Ivacaftor benzenesulfonate is a small molecule drug that binds to the cystic fibrosis transmembrane regulator (CFTR) and activates it. This leads to increased chloride transport, which in turn reduces the amount of fluid secreted by cells lining the airways. Ivacaftor benzenesulfonate has been shown to be safe and effective in treating cystic fibrosis patients who have one or two copies of the F508del mutation in the CFTR gene. It is also being evaluated for use in patients with other mutations that result in CFTR protein dysfunction. Ivacaftor benzenesulfonate was approved for use by the FDA on March 28th, 2012.</p>

<p>JNJ-38877618(OMO-1) is a novel synthetase inhibitor that has been shown to have potent anti-tumor activity in vitro and in vivo. This drug selectively inhibits the synthesis of siderophores by the iron transporter, ferric reductase, and is also effective against neutrophil chemotaxis. JNJ-38877618(OMO-1) has a low bioavailability and poor solubility, which limits its use as an oral drug. However, it has been shown to be safe when used at high doses in mice. The safety profile of this drug is yet to be determined during clinical development.</p>

<p>Copanlisib is a small molecule that targets the PI3K-Akt pathway. It has been shown to be an effective treatment for cancer cells with the PD-L1 protein. Copanlisib is a pan-PI3K inhibitor, which means it inhibits all three isoforms of the enzyme: PI3Kα, PI3Kβ, and PI3Kγ. Copanlisib has shown clinical efficacy in patients with advanced solid tumours who are resistant to other treatments. This drug has also been shown to have hepatotoxic effects in mice, although this effect was not observed in humans.</p>

<p>Taxol F is an antineoplastic product, which is derived both from natural sources and through synthetic production processes. Taxol, also known as paclitaxel, was originally extracted from the bark of the Pacific yew tree (Taxus brevifolia). However, due to the demand and sustainability concerns, it is now also produced through semi-synthetic methods involving precursor compounds extracted from renewable sources such as the European yew.</p>

<p>HBX 19818 is a synthetic molecule that has been shown to inhibit mutant FLT3. This leads to the inhibition of the proteolytic cleavage of pro-apoptotic proteins, such as BID and BAX, in cancer cells. HBX 19818 also inhibits the activity of the protein kinase domain, which is involved in cellular signaling pathways that regulate cell proliferation and survival. In addition, HBX 19818 induces apoptosis in ba/f3 cells through activation of caspase 3 and 9.<br>HBX 19818 has also been shown to have anti-inflammatory properties by inhibiting prostaglandin synthesis in vitro.</p>

<p>Deleobuvir is a non-nucleoside inhibitor, which is a synthetic chemical compound designed to target specific viral enzymes. This product is derived from meticulous pharmaceutical research aimed at addressing the challenges of Hepatitis C virus (HCV) infections. Its mode of action involves binding to the non-catalytic sites of the NS5B polymerase, an enzyme essential for the HCV RNA replication process. By inhibiting this enzyme, Deleobuvir effectively disrupts the replication cycle of the virus within the host cells.</p>

<p>SU10944 is a drug that belongs to the class of slow-release drugs. It is used as an antiangiogenic therapy for prostate cancer and other diseases. SU10944 inhibits angiogenesis by binding to the stem cell factor receptor, which prevents the growth of new blood vessels and reduces inflammation. SU10944 also blocks prostaglandin synthesis and has chemotactic activity on monocytes and macrophages, which can be used in combination with other treatments to reduce or prevent metastasis. The drug also has biofunctional properties, such as promoting the release of epidermal growth factor (EGF) and angiogenic process.</p>

<p>DDP-38003 dihydrochloride is a research tool for the study of ion channels, ligand binding and protein interactions. DDP-38003 dihydrochloride has been shown to be an inhibitor of voltage-gated potassium channels with IC50 values in the micromolar range. This compound also binds to the beta2-adrenergic receptor and acts as an agonist.</p>

<p>Dgat2 inhibitor 122 is a research tool that can be used to inhibit the activation of the Dgat2 receptor. This inhibitor binds to the ligand binding site of Dgat2, preventing the activation of Dgat2 by its ligand. The structure of this inhibitor was solved using X-ray crystallography and it is a potent competitive antagonist with high purity. It has been shown to inhibit ion channels, which may be due to its ability to block protein interactions at the membrane level.</p>

<p>Please enquire for more information about N-[2-[1,2-Dihydro-1'-[cis-4-(1-methylethyl)cyclohexyl]-3-oxospiro[isoquinoline-4(3H),4'-piperidin]-2-yl]ethyl]-sulfamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Inhibitor of multiple receptor tyrosine kinases</p>

<p>Neuropeptide S (Mouse) is a peptide with CAS No. 412938-74-0. It is an activator of ion channels and has been shown to inhibit the production of inflammatory cytokines. Neuropeptide S (Mouse) is a research tool that can be used in antibody detection, protein interactions, receptor binding, ligand activity, and pharmacology studies.</p>

<p>UNC 1025 is a research tool for the study of ion channels and receptor interactions. It is a peptide ligand that binds to the nicotinic acetylcholine receptor (nAChR) at the extracellular domain and blocks the flow of ions through the channel. UNC 1025 has been shown to activate various ion channels, including nicotinic acetylcholine receptors and voltage-gated potassium channels. UNC 1025 also inhibits enzyme activity by binding to an inhibitor site on Ligand-gated ion channels. UNC 1025 is a high purity product with CAS No. 1350549-36-8.</p>

<p>T.cruzi Inhibitor is a peptide that binds to the receptor of Trypanosoma cruzi and blocks its interaction with the ligand. This inhibitor is used as a research tool for cell biology, pharmacology, and life science. T.cruzi Inhibitor has been shown to inhibit ion channels and receptors in cells, as well as other proteins that are involved in the regulation of cellular function, growth, survival, and development. T.cruzi Inhibitor has high purity and is available in quantities from milligrams to kilograms.</p>

<p>Adamantane-1,3,5,7-tetracarboxylic acid (ADTA) is a heterocyclic compound with the chemical formula C12H22O8. It has been shown to interact with integrin receptors and form supramolecular structures in the presence of formamide. ADTA can be synthesized by condensation of butyric acid and formaldehyde in the presence of sodium hydroxide. The resulting product is a white solid that crystallizes in tetragonal space group P4/nma. The luminescence properties of ADTA have been studied using x-ray diffraction and pairwise interactions with anions.</p>

<p>Follicle Stimulating Hormone (FSH) is a protein hormone that plays a crucial role in the reproductive cycle. It stimulates the growth and development of follicles in the ovaries, which produce estrogen and progesterone. FSH also regulates spermatogenesis in men. Studies have shown that FSH has inhibitory activity on cyclin-dependent kinases, which are enzymes that regulate the cell cycle. This inhibitory activity leads to decreased cell proliferation and growth, making it a potential treatment for cancer. In vitro studies have demonstrated its effectiveness against breast and lung cancer cells lines when combined with kinase inhibitors. Additionally, FSH has been found to stimulate protein kinase activity, which may be useful in developing therapies for other diseases such as diabetes and osteoporosis.</p>

<p>Agonist of kainate class of glutamate ionotropic receptors</p>

<p>Alkyne-Agarose targets azide-modified proteins with an activation level of 10-20 umol alkyne groups per mL resin.  <br>Alkyne-Agarose is a 6% crosslinked agarose resin that is activated with terminal alkyne functional groups for covalent capturing azide-tagged biomolecules. This product is adequate to work in batch or column purification (low pressure).</p>

<p>Rabbit polyclonal SOCS6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CBX6 antibody, catalog no. 20R-1213</p>

<p>80-273 amino acids: MGSSHHHHHH SSGLVPRGSH MQVQRRKWKL NLIAELESRV LAEPVPLPAD PMELKNLEYR PVKVRGCFDH SKELYMMPRT MVDPVREARE GGLISSSTQS GAYVVTPFHC TDLGVTILVN RGFVPRKKVN PETRQKGQIE GEVDLIGMVR LTETRQPFVP ENNPERNHWH YRDLEAMARI TGAEPIFIDA NFQSTVPGGP IGGQTRVTLR NEHLQ</p>

<p>Purified recombinant YAE1D1 protein (His tag)</p>

<p>GPS2 antibody was raised in Rabbit using Human GPS2 as the immunogen</p>

<p>The TYRO3 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been developed to specifically target and neutralize the TYRO3 protein, which plays a crucial role in various cellular processes. By binding to TYRO3, this antibody effectively inhibits its function and can be used for a wide range of applications.</p>

<p>Rabbit polyclonal CYP24A1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HRG antibody, catalog no. 70R-5345</p>

<p>Rabbit Polyclonal Tyrosine Hydroxylase antibody (Ser40)</p>

<p>Rat monoclonal Flk1 antibody (biotin)</p>

<p>E. coli-derived recombinant human IFN-β</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPM3 antibody, catalog no. 70R-4890</p>

<p>Purified Polyclonal RAB11FIP4 antibody</p>

<p>The SOCS3 antibody is a highly specialized monoclonal antibody that targets the suppressor of cytokine signaling 3 (SOCS3) protein. This antibody has been extensively studied and has shown great potential in various research applications.</p>

<p>GIMAP4 antibody was raised in Rabbit using Human GIMAP4 as the immunogen</p>

<p>The Cortactin antibody is a powerful tool for researchers studying various cellular processes. It specifically targets Cortactin, a protein that plays a crucial role in cell growth and migration. This antibody can be used to investigate the effects of growth factors and tumor necrosis factor-alpha (TNF-α) on Cortactin localization and activity.</p>

<p>Purified Polyclonal ELMO1 antibody</p>

<p>Purified recombinant NEK7 protein</p>

<p>Mouse/Rabbit antigen staining reagent for use in IHC</p>

<p>DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP8B1 antibody, catalog no. 70R-9994</p>

<p>GALNTL2 antibody was raised in Rabbit using Human GALNTL2 as the immunogen</p>

<p>MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS</p>

<p>Deoxyribonuclease I antibody was raised in rabbit using bovine pancreatic deoxyribonuclease I as the immunogen.</p>

<p>Rabbit polyclonal SDHA antibody (HRP)</p>

<p>FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS</p>

<p>Hydromorphone 3 Conjugate for use in immunoassays</p>

<p>SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED</p>

<p>LSM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL</p>

<p>TRAPPC2 antibody was raised in rabbit using the middle region of TRAPPC2 as the immunogen</p>

<p>The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.</p>

<p>POGZ antibody was raised in rabbit using the C terminal of POGZ as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB3 antibody, catalog no. 70R-4412</p>

<p>CD34 Monoclonal Antibody (RPE)</p>

<p>The Caspase 2 antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody is designed to target and detect caspase 2, an enzyme involved in cell apoptosis. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various cellular processes.</p>