Compuestos y reactivos bioquímicos

<p>Purified recombinant MFAP4 protein (His tag)</p>

<p>SURF1 antibody was raised in rabbit using the N terminal of SURF1 as the immunogen</p>

<p>Rabbit polyclonal ALX3 antibody</p>

<p>IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL</p>

<p>Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS</p>

<p>Rabbit polyclonal EWS antibody</p>

<p>1-146 amino acids: MESDFYLRYY VGHKGKFGHE FLEFEFRPDG KLRYANNSNY KNDVMIRKEA YVHKSVMEEL KRIIDDSEIT KEDDALWPPP DRVGRQELEI VIGDEHISFT TSKIGSLIDV NQSKDPEGLR VFYYLVQDLK CLVFSLIGLH FKIKPILEHH HHHH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCGN antibody, catalog no. 70R-2887</p>

<p>The CacyBP antibody is a powerful tool in the field of Life Sciences. It is an anti-mesothelin antibody that has been extensively studied for its potential therapeutic applications. Mesothelin is a cell surface glycoprotein that is highly expressed in various cancers, making it an attractive target for cancer therapy.</p>

<p>The FAK antibody is a highly effective neutralizing agent that targets dopamine. It is a monoclonal antibody produced by a hybridoma cell line. This antibody has been shown to specifically bind to interleukin-6 (IL-6), inhibiting its activity and preventing the activation of downstream signaling pathways. The FAK antibody also exhibits cytotoxic effects on cancer cells, making it a promising therapeutic option for the treatment of various malignancies. Additionally, this antibody can be used in research settings to study the role of IL-6 in different biological processes. With its high specificity and potency, the FAK antibody is a valuable tool for scientists and clinicians alike.</p>

<p>Affinity purified Rabbit polyclonal COPD antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf31 antibody, catalog no. 70R-8760</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Trazodone Conjugate for use in immunoassays</p>

<p>Purified Horse IgG (Fab'2)</p>

<p>Ornithine decarboxylase antibody was raised in guinea pig using recombinant human ornithine decarboxylase produced in E. coli as the immunogen.</p>

<p>GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDRG1 antibody, catalog no. 70R-1121</p>

<p>Rabbit polyclonal TAS2R10 antibody</p>

<p>Rabbit polyclonal OR4A15 antibody</p>

<p>F2RL2 antibody was raised in rabbit using the C terminal of F2RL2 as the immunogen</p>

<p>Recombinant Human RASL12 protein</p>

<p>Rabbit polyclonal BIK antibody (Thr33)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf122 antibody, catalog no. 70R-4043</p>

<p>Rabbit polyclonal UGT1A6 antibody</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM134B antibody, catalog no. 70R-6834</p>

<p>Purified recombinant KRT16 protein (His tag)</p>

<p>Purified Rabbit polyclonal EIF3D antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC12 antibody, catalog no. 70R-6149</p>

<p>GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP</p>

<p>PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG</p>

<p>AKT1 antibody was raised in Mouse using a purified recombinant fragment of human AKT1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal HSF1 antibody (Ser121)</p>

<p>Mouse monoclonal CA 19-9 antibody (Prediluted for IHC)</p>

<p>Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL</p>

<p>Mouse monoclonal HVEM antibody (biotin)</p>

<p>Purified Rabbit polyclonal OR5AS1 antibody</p>

<p>Rabbit polyclonal RPL13 antibody</p>

<p>Recombinant Human Il2(C160S) protein (His tag)</p>

<p>ZFP287 antibody was raised in rabbit using the N terminal of ZFP287 as the immunogen</p>

<p>PDGFr beta antibody was raised in Mouse using a purified recombinant fragment of human PDGFr beta expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal REQU antibody</p>

<p>Mouse monoclonal NUDT9 antibody</p>

<p>Rabbit polyclonal TLP7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAAR5 antibody, catalog no. 70R-9833</p>

<p>CD23 antibody was raised in mouse using human peripheral myeloma cells as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT75 antibody, catalog no. 70R-3038</p>

<p>Purified recombinant E.coli sodA protein</p>

<p>The PIN1 antibody is a powerful tool in the field of Life Sciences. It is an antibody specifically designed to target and bind to PIN1, a protein that plays a crucial role in cell growth and development. This antibody has been extensively studied and proven to be effective in various research areas.</p>

<p>Troponin I antibody (cardiac) was raised in mouse using animo acid residues 169-178 of cTnI as the immunogen.</p>

<p>C1ORF110 antibody was raised using the middle region of C1Orf110 corresponding to a region with amino acids SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL</p>

<p>1-440 amino acids: MGSSHLLNKG LPLGVRPPIM NGPLHPRPLV ALLDGRDCTV EMPILKDVAT VAFCDAQSTQ EIHEKVLNEA VGALMYHTIT LTREDLEKFK ALRIIVRIGS GFDNIDIKSA GDLGIAVCNV PAASVEETAD STLCHILNLY RRATWLHQAL REGTRVQSVE QIREVASGAA RIRGETLGII GLGRVGQAVA LRAKAFGFNV LFYDPYLSDG VERALGLQRV STLQDLLFHS DCVTLHCGLN EHNHHLINDF TVKQMRQGAF LVNTARGGLV DEKALAQALK EGRIRGAALD VHESEPFSFS QGPLKDAPNL ICTPHAAWYS EQASIEMREE AAREIRRAIT GRIPDSLKNC VNKDHLTAAT HWASMDPAVV HPELNGAAYR YPPGVVGVAP TGIPAAVEGI VPSAMSLSHG LPPVAHPPHA PSPGQTVKPE ADRDHASDQL</p>

<p>Rotavirus antibody (HRP) was raised in goat using nebraska calf diarrhea virus as the immunogen.</p>

<p>The RGR antibody is a highly specialized antibody that targets the actin protein. It has cytotoxic properties, meaning it can kill cells that express the actin protein. This antibody specifically binds to the growth factor-1 receptor (GFR-1), which is involved in cell growth and development. The RGR antibody is colloidal in nature, allowing for easy dispersion and application. Additionally, it has neutralizing properties against certain factors such as glucagon and endothelial growth factors. The RGR antibody is available in both polyclonal and monoclonal forms, providing options for different research needs. It is widely used in life sciences research and has applications in various fields, including immunology and cancer biology. If you are looking for an effective tool to study actin-related processes or to investigate GFR-1 signaling pathways, the RGR antibody is an excellent choice.</p>

<p>Purified recombinant Human GMPR2 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRABP2 antibody, catalog no. 70R-2749</p>

<p>Mouse monoclonal KHK antibody</p>

<p>Mouse monoclonal COX6A1 antibody</p>

<p>The TIMM10 antibody is a polyclonal antibody that specifically targets the TIMM10 protein. This protein is located in the mitochondria and plays a crucial role in various cellular processes, including hormone and growth factor signaling, as well as β-catenin stabilization. The TIMM10 antibody binds to the amino-terminal region of the protein, allowing for its detection and analysis in biological samples.</p>

<p>Purified recombinant KLF7 protein (His tag)</p>

<p>The LAT antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody has been extensively studied for its role in various biological processes, including cell proliferation, differentiation, and survival.</p>

<p>OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR6C70 antibody, catalog no. 70R-1722</p>

<p>Rabbit polyclonal CNPY2 antibody (HRP)</p>

<p>Purified recombinant IFI30 protein (His tag)</p>

<p>Region of Prolactin protein corresponding to amino acids MLPVCSGGDC QTPLPELFDR VVMLSHYIHT LYTDMFIEFD KQYVQDREFI AKAINDCPTS SLATPEDKEQ AQKVPPEVLL NLILSLVHSW NDPLFQLITG LGGIHEAPDA IISRAKEIEE QNKRLLEGIE KIISQAYPEA KGNEIYLVWS QLPSLQGVDE ESKDLAFYNN IRCLRRDSHK VDNYLKFLRC QIVHKNNC.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH6A1 antibody, catalog no. 70R-6488</p>

<p>Rabbit polyclonal FGF2 antibody (FITC)</p>

<p>Mouse monoclonal Phycoerythrin antibody</p>

<p>NARG1L antibody was raised using the middle region of NARG1L corresponding to a region with amino acids RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL</p>

<p>Rat monoclonal LPAM1 antibody (PE)</p>

<p>ARC antibody was raised using the middle region of ARC corresponding to a region with amino acids ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF</p>

<p>IL20 antibody was raised in goat using highly pure recombinant human IL-20 as the immunogen.</p>

<p>Mouse monoclonal Keratin 7 antibody (N-terminus)</p>

<p>VZV ORF26 immunodominant regions containing amino acids 9-33 and 184-208.</p>

<p>The SMS antibody is a monoclonal antibody that targets fatty acids and is used in antiestrogen therapy. It specifically binds to the bromodomain, a protein domain involved in gene regulation, and has been shown to have an effect on adipose tissue. The SMS antibody is also known for its natriuretic properties, meaning it promotes the excretion of sodium by the kidneys. This monoclonal antibody is widely used in life sciences research and has applications in various fields such as growth factor studies and drug antibody development. It has also been studied as a potential therapeutic target for cdk4/6 inhibitors, which are drugs used in cancer treatment. With its colloidal properties, the SMS antibody offers great potential for advancing scientific knowledge and medical advancements.</p>

<p>Phospho EGFR antibody was raised in mouse using a sythetic peptide conjugated to KLH with contains the Y1173 motif of the human EGFR as the immunogen.</p>

<p>TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen</p>

<p>MCCC2 antibody was raised in Rabbit using Human MCCC2 as the immunogen</p>

<p>Rabbit polyclonal SSX4 antibody</p>

<p>TMTC4 antibody was raised using the N terminal of TMTC4 corresponding to a region with amino acids NKDLQAETPLGDLWHHDFWGSRLSSNTSHKSYRPLTVLTFRINYYLSGGF</p>

<p>XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM</p>

<p>APOH antibody was raised in Rabbit using Human APOH as the immunogen</p>

<p>SLC24A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSPC111 antibody, catalog no. 70R-3260</p>

<p>Mouse monoclonal AChR alpha antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCL11A antibody, catalog no. 70R-8372</p>

<p>Syk Inhibitor is a small molecule compound designed to inhibit the activity of spleen tyrosine kinase (Syk), which is derived through advanced chemical synthesis from a variety of organic substrates. With its mode of action as a kinase inhibitor, Syk Inhibitor functions by specifically binding to the ATP-binding site of the Syk enzyme. This binding effectively blocks the phosphorylation processes necessary for signal transduction pathways that are critical in immune cell activation and function.</p>

<p>Rabbit polyclonal ZNF699 antibody</p>

<p>Mouse monoclonal Complement D antibody</p>

<p>Purified recombinant MDS1 protein (His tag)</p>

<p>The Cytokeratin Antibody Cocktail is a powerful tool for immunohistochemistry and research applications. This cocktail contains a mixture of monoclonal antibodies that specifically target various cytokeratins, which are intermediate filament proteins found in epithelial cells. These monoclonal antibodies have been extensively validated and provide high specificity and sensitivity in detecting cytokeratin expression.</p>

<p>Rabbit polyclonal MPO antibody (Prediluted for IHC)</p>

<p>Rabbit anti-cat IgG (HRP) was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>MRPL48 antibody was raised in Rabbit using Human MRPL48 as the immunogen</p>

<p>Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND</p>

<p>The BHMT antibody is a highly specialized antibody used in Life Sciences research. It targets the BHMT protein, which plays a crucial role in various biological processes. The BHMT antibody has been shown to have neutralizing properties against the fibronectin, cholinergic, insulin, and collagen pathways. This makes it an essential tool for studying the interactions between these proteins and their associated functions.</p>

<p>PINK1 protein is a key player in cellular processes and has been studied extensively in the field of Life Sciences. It is involved in various functions, including the regulation of mesenchymal stem cells and collagen production. PINK1 protein has been utilized for ultrasensitive detection in human serum using electrochemical impedance spectroscopy, making it a valuable tool for diagnostic purposes. Additionally, recombinant proteins and monoclonal antibodies targeting PINK1 have been developed for research applications. These antibodies have shown neutralizing properties against reactive forms of PINK1, further highlighting their potential therapeutic significance. With its unique characteristics and applications, PINK1 protein continues to contribute to advancements in the field of Life Sciences.</p>

<p>Rabbit polyclonal RAB33A antibody</p>