Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.130 productos)
- Por objetivo biológico(99.159 productos)
- Según efectos farmacológicos(6.787 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.747 productos)
- Metabolitos secundarios(14.222 productos)
Se han encontrado 130579 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
HSD3B2 antibody
<p>HSD3B2 antibody was raised using the N terminal of HSD3B2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN</p>Pureza:Min. 95%RANK protein
<p>Region of RANK protein corresponding to amino acids PAMMEGSWLD VARRGKPEAQ PFAHLTINAA DIPSGSHKVS LSSWYHDRGW AKISNMTLSN GKLRVNQDGF YYLYANICFR HHETSGSVPA DYLQLMVYVV KTSIKIPSSH NLMKGGSTKN WSGNSEFHFY SINVGGFFKL RAGEEISVQV SNPSLLDPDQ DATYFGAFKV QDID.</p>Pureza:Min. 95%N-Desmethyl-N-cyclopentyl tadalafil
CAS:<p>N-Desmethyl-N-cyclopentyl tadalafil is an inhibitor of cyclic nucleotide phosphodiesterase (PDE) 5. It inhibits the breakdown of cGMP, which promotes vasodilation and erectile function by increasing blood flow to the penis. N-Desmethyl-N-cyclopentyl tadalafil has been shown to be a potent inhibitor of PDE5 with IC50 values in the low nanomolar range.</p>Fórmula:C26H25N3O4Pureza:Min. 95%Peso molecular:443.5 g/molCD45 antibody
<p>CD45 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>Pureza:Min. 95%ZNF780B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF780B antibody, catalog no. 70R-8873</p>Pureza:Min. 95%CCDC74A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC74A antibody, catalog no. 70R-4386</p>Pureza:Min. 95%LANCL3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LANCL3 antibody, catalog no. 70R-9359</p>Pureza:Min. 95%SERINC2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERINC2 antibody, catalog no. 70R-9351</p>Pureza:Min. 95%InfIuenza A Virus Nucleoprotein antibody
<p>Mouse monoclonal InfIuenza A Virus Nucleoprotein antibody</p>NOMO1 antibody
<p>NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD</p>Pureza:Min. 95%Calpastatin antibody
<p>Calpastatin antibody was raised in mouse using bovine skeletal muscle calpastatin as the immunogen.</p>GSK3 α antibody
<p>GSK3 alpha antibody was raised in Mouse using a purified recombinant fragment of GSK3 alpha expressed in E. coli as the immunogen.</p>VARS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VARS antibody, catalog no. 70R-3182</p>Pureza:Min. 95%GABRD antibody
<p>GABRD antibody was raised in rabbit using the N terminal of GABRD as the immunogen</p>Pureza:Min. 95%KIF25 antibody
<p>KIF25 antibody was raised in rabbit using the N terminal of KIF25 as the immunogen</p>Pureza:Min. 95%Dnaja1 antibody
<p>Dnaja1 antibody was raised in rabbit using the N terminal of Dnaja1 as the immunogen</p>Pureza:Min. 95%Amodiaquine Hydrochloride
<p>Amodiaquine Hydrochloride (USP grade powder) chemical reference substance</p>Pureza:Min. 95%KIF2C antibody
<p>KIF2C antibody was raised using the N terminal of KIF2C corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT</p>Pureza:Min. 95%Chromogranin A antibody
<p>Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.</p>B3GALT6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALT6 antibody, catalog no. 70R-7452</p>Pureza:Min. 95%4EBP1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections due to its bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high potency has been demonstrated through the patch-clamp technique on human erythrocytes. In addition, it undergoes various metabolic transformations such as hydrolysis, oxidation, reduction, and conjugation. Rifapentine specifically targets markers expressed in Mycobacterium tuberculosis strains and hinders their growth in culture.</p>STAT5A antibody
<p>The STAT5A antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to STAT5A, a protein involved in various cellular processes. This monoclonal antibody has been extensively tested and proven to have high specificity and sensitivity.</p>Pureza:Min. 95%CHI3L1 antibody
<p>CHI3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL</p>Pureza:Min. 95%CD94 antibody
<p>CD94 antibody was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.</p>TYRO3 antibody
<p>The TYRO3 antibody is a monoclonal antibody that has neutralizing properties against interferon (IFN). It is used as an inhibitor to block the activity of IFN and its downstream effects. This antibody specifically targets the TYRO3 receptor, which is involved in the signaling pathway of IFN. By blocking this receptor, the TYRO3 antibody prevents the activation of downstream pathways that are mediated by IFN.</p>Hepatitis C Virus NS3 protein (His tag)
<p>1225-1456 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSVAHL HAPTGSGKST KVPAAYAAQG YKVLVLNPSV AATLGFGAYM SKAHGVDPNI RTGVRTITTG SPITYSTYGK FLADGGCSGG AYDIIICDEC HSTDATSILG IGTVLDQAET AGARLVVLAT ATPPGSVTVS HPNIEEVALS TTGEIPFYGK AIPLEVIKGG RHLIFCHSKK KCDELAAKLV ALGINAVAYY RGLDVSVIPT SGDVVVVSTD ALMTGFTGDF DSVIDCNT</p>Pureza:Min. 95%Goat anti Human IgG (H + L) (rhodamine)
<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>Pureza:Min. 95%Androgen Receptor antibody
<p>The Androgen Receptor antibody is a powerful tool used in Life Sciences research. It is available as both Polyclonal Antibodies and Monoclonal Antibodies, providing researchers with options to suit their specific needs. This antibody targets the Androgen Receptor, a protein that plays a crucial role in steroid signaling and growth factor regulation.</p>ZNF93 antibody
<p>ZNF93 antibody was raised in rabbit using the N terminal of ZNF93 as the immunogen</p>Pureza:Min. 95%Sheep anti Bovine IgG1
<p>Affinity purified Sheep polyclonal Sheep anti Bovine IgG1 antibody</p>Pureza:Min. 95%IRF7 antibody
<p>IRF7 antibody was raised in mouse using recombinant human IRF-7 (1-150aa) purified from E. coli as the immunogen.</p>CD5l protein
<p>CD5l protein is a pluripotent stem cell-derived protein that plays a crucial role in various biological processes. It has been shown to have therapeutic potential in the treatment of choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. CD5l protein can neutralize the activity of certain growth factors involved in this process, thereby inhibiting the formation of new blood vessels.</p>Pureza:Min. 95%ERCC1 antibody
<p>The ERCC1 antibody is a polyclonal antibody that has been developed for use in life sciences research. It is used to detect and measure the expression of ERCC1, a protein involved in DNA repair and maintenance. This antibody has been shown to have inhibitory properties against neurotrophic factors, TGF-β1, insulin, and chemokines. It can also neutralize the activity of interferons and other activated proteins. The ERCC1 antibody is commonly used in immunoassays and can be used to study various cellular processes such as collagen synthesis, protein kinase activity, and the effects of nuclear inhibitors.</p>LOC730950 antibody
<p>LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen</p>Pureza:Min. 95%WDR33 antibody
<p>WDR33 antibody was raised using the middle region of WDR33 corresponding to a region with amino acids TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL</p>Pureza:Min. 95%ZNF652 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF652 antibody, catalog no. 70R-7878</p>Pureza:Min. 95%MIF antibody
<p>The MIF antibody is a potent neutralizing agent that targets the growth factor and chemokine known as Macrophage Migration Inhibitory Factor (MIF). This polyclonal antibody binds to MIF, preventing its interaction with other molecules and inhibiting its biological activity. By blocking the action of MIF, this antibody can modulate immune responses, including the production of interferon and colony-stimulating factors. Additionally, it has antiviral properties and may play a role in regulating cell adhesion through interactions with E-cadherin. With its high specificity and effectiveness, the MIF antibody is a valuable tool for researchers studying immune responses and inflammatory diseases.</p>HSV1 gD antibody
<p>HSV1 gD antibody was raised in mouse using herpes simplex I and II-infected cells as the immunogen.</p>Redd1 inducer
CAS:<p>Redd1 is a transcriptional regulator that functions as a negative regulator of inflammation. Redd1 induces the expression of IL-12 in human monocytes, which can lead to the suppression of inflammatory responses. Redd1 also inhibits the development of regulatory T cells and Th17 cells, which are important for maintaining immune tolerance. Redd1 is induced by microbial products and the pathogen Toxoplasma gondii, but it is overridden by IL-12 in the presence of this cytokine. The induction of Redd1 is mediated by IL-12 through activation of STAT3 transcription factor.<br>!--END--></p>Fórmula:C23H26N2O4Pureza:Min. 95%Peso molecular:394.5 g/molCHRNA3 antibody
<p>CHRNA3 antibody was raised in rabbit using the N terminal of CHRNA3 as the immunogen</p>CD3 antibody
<p>CD3 antibody was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>Goat anti Mouse IgG + IgA + IgM (H + L) (biotin)
<p>Goat anti-mouse IgG/IgA/IgM (H+L) (biotin) was raised in goat using murine IgG, IgA and IgM whole molecules as the immunogen.</p>Pureza:Min. 95%TPX2 antibody
<p>TPX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK</p>Pureza:Min. 95%SCG2 antibody
<p>SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ</p>IL13 antibody
<p>IL13 antibody was raised in rabbit using highly pure recombinant murine IL-13 as the immunogen.</p>Pureza:Min. 95%GLUT12 antibody
<p>GLUT12 antibody was raised in rabbit using a 15 amino acid peptide from human GT122 as the immunogen.</p>Pureza:Min. 95%TRIM32 antibody
<p>The TRIM32 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the TRIM32 protein, which is an important molecule involved in various cellular processes. This polyclonal antibody is produced by immunizing animals with the target molecule, resulting in a diverse range of antibodies that can recognize different epitopes on TRIM32.</p>Lyrm4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Lyrm4 antibody, catalog no. 70R-9499</p>Pureza:Min. 95%Uhmk1 antibody
<p>Uhmk1 antibody was raised in rabbit using the C terminal of Uhmk1 as the immunogen</p>Pureza:Min. 95%PLCG2 antibody
<p>The PLCG2 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets PLCG2, an enzyme involved in various cellular processes. This antibody has been widely used to study the role of PLCG2 in signal transduction pathways and its association with diseases.</p>Collagen Type XI α 2 antibody
<p>Collagen Type XI Alpha 2 antibody was raised using the N terminal of COL11A2 corresponding to a region with amino acids TADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETELGPALSAETAHSG</p>Pureza:Min. 95%ADCY2 antibody
<p>ADCY2 antibody was raised in rabbit using the middle region of ADCY2 as the immunogen</p>Pureza:Min. 95%Alkaline Phosphatase antibody
<p>Alkaline phosphatase antibody was raised in mouse using human placental alkaline phosphatase as the immunogen.</p>AQP1 antibody
<p>The AQP1 antibody is a growth factor that belongs to the class of monoclonal antibodies. It has been shown to inhibit the multidrug resistance protein and enhance the expression of E-cadherin, a cell adhesion molecule. This antibody specifically targets AQP1, which is a water channel protein involved in various physiological processes. The AQP1 antibody has been extensively used in life sciences research to study its role in different cellular pathways. Additionally, it has been found to have cytotoxic effects on cancer cells and can interfere with nuclear signaling pathways. Its potential as a therapeutic agent is being explored in various fields, including oncology and immunology.</p>
