Compuestos y reactivos bioquímicos

<p>Mouse monoclonal MICAL1 antibody</p>

<p>The NOTCH1 antibody is a highly specialized monoclonal antibody that targets the activated form of NOTCH1, a cell surface receptor involved in various cellular processes. This antibody specifically binds to the intracellular domain of NOTCH1, preventing its interaction with downstream signaling molecules such as β-catenin and TGF-beta. By blocking NOTCH1 activation, this antibody inhibits the expression of genes involved in cell proliferation, survival, and differentiation.</p>

<p>This antibody reacts with heavy chains on Goat IgG.</p>

<p>RUNDC2A antibody was raised in rabbit using the N terminal of RUNDC2A as the immunogen</p>

<p>GPN1 antibody was raised in Rabbit using Human GPN1 as the immunogen</p>

<p>DCX antibody was raised using a synthetic peptide corresponding to a region with amino acids PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR</p>

<p>KLHL8 antibody was raised in rabbit using the N terminal of KLHL8 as the immunogen</p>

<p>Purified recombinant EEF1G protein (His tag)</p>

<p>Factor I antibody was raised in Mouse using purified Factor I from human blood as the immunogen.</p>

<p>Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG</p>

<p>COX2 antibody is a polyclonal antibody that specifically targets cyclooxygenase-2 (COX-2), an enzyme involved in the production of inflammatory prostaglandins. This antibody is commonly used in research to study the role of COX-2 in various biological processes. It has been shown to be effective in detecting COX-2 expression in blood plasma and various tissues, including actin filaments and alpha-synuclein (α-syn). The COX2 antibody can be used for immunohistochemistry, Western blotting, and other applications to investigate the expression and localization of COX-2 in different cell types and tissues. Its high specificity and sensitivity make it a valuable tool for researchers studying the role of COX-2 in inflammation, cancer, and other diseases.</p>

<p>Introducing 6-Fluoro-3-indoxyl-beta-D-galactopyranoside: The Ultimate Antituberculosis Drug</p>

<p>Mouse monoclonal HSD17B10 antibody</p>

<p>The Myoglobin antibody is a highly specific and effective tool used in spectrometric and electrode-based assays. This Monoclonal Antibody has been developed to target the myoglobin protein, which plays a crucial role in oxygen storage and transport in muscle tissues. The Myoglobin antibody has been extensively tested and proven to have neutralizing properties against myoglobin, making it an ideal choice for research studies involving myoglobin-related processes.</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN</p>

<p>Purified recombinant MX2 protein (His tag)</p>

<p>Rabbit polyclonal RE57611p antibody</p>

<p>Rabbit polyclonal PSME3 antibody (FITC)</p>

<p>Purified Polyclonal TIN2 antibody</p>

<p>Purified Polyclonal ANT4 antibody</p>

<p>CHRNA5 antibody was raised in rabbit using the middle region of CHRNA5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL4 antibody, catalog no. 70R-2275</p>

<p>SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK</p>

<p>Rabbit polyclonal PKC theta antibody (Thr538)</p>

<p>Rabbit polyclonal RBMS1 antibody</p>

<p>HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI</p>

<p>(+)-CI 1044 is a potent synthetic compound that serves as a selective inhibitor of enzyme activity. It is derived through chemical synthesis, ensuring high purity and consistency. The compound exerts its effects by targeting specific enzymatic pathways, thereby altering the biochemical processes in targeted cells or tissues. This targeted inhibition is achieved through binding to the enzyme's active site, modulating its activity, and influencing downstream signaling pathways.</p>

<p>The CPA1 antibody is a highly reactive monoclonal antibody that is used in antiestrogen therapy. It specifically targets and binds to the fatty acid CPA1, inhibiting its activity. This antibody has been shown to block the interaction between CPA1 and interleukin-6, a growth factor involved in cancer cell proliferation. Additionally, the CPA1 antibody acts as a potent inhibitor of protein kinase activity, specifically targeting the CDK4/6 pathway. This makes it an effective tool for studying cell cycle regulation and potential therapeutic applications. With its high specificity and affinity, the CPA1 antibody is a valuable asset in life sciences research.</p>

<p>CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC</p>

<p>The AXL antibody is a highly specific monoclonal antibody that targets the AXL receptor tyrosine kinase. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been validated for use in multiple species and has shown high specificity and sensitivity.</p>

<p>Rabbit polyclonal EFNA2 antibody</p>

<p>The BRAF antibody is a highly potent monoclonal antibody that belongs to the group of chemokine antibodies. It exhibits strong cytotoxic and antitumor activity, making it an effective treatment for various types of cancer. This antibody specifically targets BRAF, a protein involved in cell growth and division, and neutralizes its function. By inhibiting BRAF, the antibody prevents the growth and spread of cancer cells.</p>

<p>Purified native Sheep Troponin I protein (Skeletal Muscle)</p>

<p>Rabbit polyclonal ZNF592 antibody (HRP)</p>

<p>GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA</p>

<p>CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL</p>

<p>Mouse monoclonal CD79a antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDC antibody, catalog no. 70R-5520</p>

<p>Rabbit polyclonal Zap 70 antibody</p>

<p>KIF5A antibody was raised in Rabbit using Human KIF5A as the immunogen</p>

<p>The Apolipoprotein A1 antibody is a polyclonal antibody that specifically targets and binds to apolipoprotein A1, a protein involved in lipid metabolism. This antibody is widely used in life sciences research to study the functions and interactions of apolipoprotein A1 in various biological processes.</p>

<p>CD104 antibody was raised in rat using tumor-associated antigen TSP-180 immunoaffinity purified from a transplantable BALB/c mouse lung cell carcinoma as the immunogen.</p>

<p>The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.</p>

<p>The CHD1L antibody is a polyclonal antibody that targets the growth factor CHD1L. It can be used in various applications, including insulin antibody assays and as a research tool for studying the role of CHD1L in different biological processes. This antibody has also been used in combination with other antibodies, such as trastuzumab, to detect specific proteins or biomarkers in samples. Additionally, it has shown reactivity with thymidylate synthase and anti-HER2 antibodies in human serum, making it a valuable tool for diagnostic purposes. The CHD1L antibody can be used in both monoclonal and polyclonal forms, offering flexibility for different experimental setups. Its specificity towards glial fibrillary acidic protein (GFAP) makes it particularly useful for studying autoimmune diseases or neurological disorders involving GFAP autoantibodies. Researchers can rely on this antibody to provide accurate and reliable results in their investigations.</p>

<p>KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR</p>

<p>IL4 antibody was raised in mouse using recombinant human IL-4 as the immunogen.</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>Rabbit polyclonal MIF antibody (biotin)</p>

<p>MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ</p>

<p>Rabbit polyclonal GPR173 antibody</p>

<p>Mouse monoclonal CD3 antibody (FITC)</p>

<p>PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL</p>

<p>TNF beta antibody was raised in rabbit using highly pure recombinant human TNF-beta as the immunogen.</p>

<p>LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN</p>

<p>Rabbit polyclonal PCYT2 antibody</p>

<p>Rabbit polyclonal DYR1B antibody</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Rabbit polyclonal MECP2 antibody (Ser80)</p>

<p>Rabbit polyclonal Daxx antibody (Ser668)</p>

<p>The MCPH1 antibody is a highly specialized antibody that targets the protein MCPH1. This protein plays a crucial role in various biological processes, including collagen synthesis, phosphorylation site regulation, and antinociceptive activity. The MCPH1 antibody is widely used in Life Sciences research to study the function and regulation of this protein.</p>

<p>Mouse monoclonal PDE6G antibody</p>

<p>NFKB P52 antibody was raised in rabbit using human NFKB2 p52/p100 peptide corresponding to residues 1-19 of the human protein conjugated to KLH as the immunogen.</p>

<p>PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE</p>

<p>Mouse monoclonal RNH1 antibody</p>

<p>ZNF226 antibody was raised in rabbit using the middle region of ZNF226 as the immunogen</p>

<p>S100PBP antibody was raised using the middle region of S100PBP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>The GLP1R antibody is a peptide nucleic acid that specifically binds to GLP-1 receptor (GLP1R) binding proteins. It is a polyclonal antibody commonly used in Life Sciences research. This antibody has been shown to block the activation of factor-α, a key mediator of inflammation. Additionally, it has been demonstrated to enhance the natriuretic response in animal models. The GLP1R antibody can be used in various experimental techniques such as electrode assays, botulinum toxin studies, and β-catenin signaling analysis. This high-quality antibody is produced using state-of-the-art technology and undergoes rigorous quality control testing to ensure optimal performance. Order now and unlock new insights into GLP-1 receptor biology.</p>

<p>MAGEA4 antibody was raised in Rabbit using Human MAGEA4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA12 antibody, catalog no. 70R-9013</p>

<p>The SERCA1 antibody is a highly specialized antibody that plays a crucial role in nitrogen metabolism. It belongs to the class of imidazolidine derivatives and has neutralizing properties. This antibody is used in various research applications, including the development of monoclonal antibodies for targeted therapies. It has been shown to inhibit the activity of TNF-α (tumor necrosis factor-alpha), a growth factor involved in inflammation and immune response. Additionally, the SERCA1 antibody has been found to interact with other proteins such as usnic acid and the rubisco enzyme, further highlighting its versatility and potential applications. Polyclonal Antibodies specific to SERCA1 are also available, providing researchers with a comprehensive toolset for their studies. Furthermore, this antibody has shown interactions with cyanobacterial proteins, interleukin-6, hepcidin, and parathyroid hormone-related peptide, suggesting its involvement in various biological processes and signaling pathways. With its wide range of applications and potential therapeutic</p>

<p>Purified recombinant PRRX1 protein (His tag)</p>

<p>Purified Rabbit polyclonal CD124 antibody</p>

<p>The LOX antibody is a monoclonal antibody that specifically targets the enzyme lysyl oxidase (LOX). LOX is involved in collagen cross-linking, which plays a crucial role in tissue development and repair. This antibody has been widely used in Life Sciences research to study the function of LOX and its potential as a therapeutic target.</p>

<p>MYOZ1 antibody was raised in Rabbit using Human MYOZ1 as the immunogen</p>

<p>USP15 antibody was raised in rabbit using the C terminal of USP15 as the immunogen</p>

<p>ZNF138 antibody was raised in rabbit using the N terminal of ZNF138 as the immunogen</p>

<p>Recombinant human TAX1BP3 protein (His tag)</p>

<p>The TrkB antibody is a highly reactive and neutralizing polyclonal antibody that is used in the field of Life Sciences. It has the ability to bind to TGF-beta, a protein involved in various cellular processes. The TrkB antibody can be used as a diagnostic reagent for detecting the presence of alpha-fetoprotein, a biomarker for certain diseases. This antibody is produced using state-of-the-art techniques and undergoes rigorous quality control to ensure its effectiveness. It is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. The TrkB antibody is conjugated with streptavidin, which enables easy detection and visualization using techniques such as immunohistochemistry or western blotting. With its high affinity and specificity, this antibody is an invaluable tool for studying cellular signaling pathways and investigating disease mechanisms.</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0317 antibody, catalog no. 70R-6288</p>

<p>The p70 S6 Kinase antibody is a polyclonal antibody that specifically targets the dopamine-activated protein complex. It can be used in various applications such as interferon and interleukin-6 research. This antibody has been extensively tested using chromatographic techniques and has shown high specificity and sensitivity. The p70 S6 Kinase antibody is available as a monoclonal antibody and has been validated in various studies with teriparatide, haloperidol, droperidol, and other related compounds. It is widely used in Life Sciences research to study the protein complex and its neutralizing effects on plasma levels.</p>

<p>DDX51 antibody was raised in rabbit using the middle region of DDX51 as the immunogen</p>

<p>The GLUT3 antibody is a polyclonal antibody that targets the glucose transporter 3 (GLUT3) protein. It is widely used in life sciences research to study the role of glucose transporters in various cellular processes.</p>

<p>Recombinant Mouse TGFB1 protein (His tag)</p>

<p>Rabbit polyclonal PIP5K1B antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to treat tuberculosis infections and contains active compounds with potent bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>MMP3 antibody was raised in Rabbit using Human MMP3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPESP antibody, catalog no. 70R-3306</p>

<p>Mouse pan macrophages antibody was raised in rat using mouse lymph node tissue as the immunogen.</p>

<p>The GRIN1 antibody is a highly specialized antibody used in the field of Life Sciences. It targets the methyl transferase enzyme, which plays a crucial role in gene regulation and protein function. This antibody is commonly used in nuclear research to study the acetylation and phosphorylation of proteins involved in various cellular processes.</p>

<p>The HSP27 antibody is a monoclonal antibody that targets the heat shock protein 27 (HSP27). HSP27 is a growth factor that plays a crucial role in various cellular processes, including cell survival, differentiation, and apoptosis. This antibody specifically binds to HSP27 and can be used for research purposes in the Life Sciences field.</p>

<p>LOC390338 antibody was raised in rabbit using the middle region of LOC390338 as the immunogen</p>

<p>Rabbit polyclonal DAPK2 antibody (Ser318)</p>

<p>GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASPHD2 antibody, catalog no. 70R-3531</p>

<p>The GR antibody is a highly specialized antibody that targets the p38 MAPK pathway. It has antiviral properties and is particularly effective against acidic environments. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also binds to nuclear factor kappa-light-chain-enhancer, which regulates gene expression. The GR antibody is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in life sciences research. It can be used in immunoassays to detect the presence of activated p38 mitogen-activated protein kinase (MAPK) and caspase-9, as well as growth factors. With its high specificity and sensitivity, the GR antibody is an invaluable tool for researchers studying various cellular processes and signaling pathways.</p>

<p>Nortriptyline Conjugate for use in immunoassays</p>

<p>Recombinant human DHRS4 protein (His tag)</p>