Compuestos y reactivos bioquímicos

<p>AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD9 antibody, catalog no. 70R-6076</p>

<p>The NR3C1 antibody is a highly specialized product used in the field of Life Sciences. It is specifically designed to target and bind to the dopamine-activated NR3C1 receptor, which plays a crucial role in various biological processes. This antibody is commonly used in research settings to study the effects of growth factors and human serum on NR3C1 activation.</p>

<p>ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA</p>

<p>CD93 protein is a growth factor that plays a crucial role in various biological processes. It is known to be involved in cell proliferation, differentiation, and migration. CD93 protein has been found to be associated with the development of autoantibodies in certain autoimmune diseases. This protein can also act as a receptor for certain toxins, enabling their entry into cells. CD93 protein can be conjugated with other proteins or antigens to enhance their activity or specificity. Monoclonal antibodies against CD93 protein have been developed for research and diagnostic purposes. The proteolytic activity of CD93 protein allows it to cleave specific substrates, leading to various cellular responses. Additionally, CD93 protein has been shown to interact with cellulose and cations, further expanding its functional versatility. Overall, CD93 protein is an essential component in numerous physiological processes and holds great potential for therapeutic applications.</p>

<p>PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEK7 antibody, catalog no. 70R-2229</p>

<p>Purified recombinant Human AASDHPPT protein</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp, which have shown its high frequency of human activity. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>SLC7A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FKBP11 antibody, catalog no. 70R-7231</p>

<p>KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH</p>

<p>Purified Polyclonal NANOGP8 antibody</p>

<p>ZNF169 antibody was raised in rabbit using the middle region of ZNF169 as the immunogen</p>

<p>The PIN1 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and monoclonal antibodies. This antibody specifically targets PIN1, a protein that plays a crucial role in various cellular processes. PIN1 is involved in regulating collagen synthesis, chemokine production, and the activity of growth factors.</p>

<p>The PP2A antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to protein phosphatase 2A (PP2A), an important enzyme involved in cell growth and regulation. This antibody can be used for various applications, including research on growth factors, protein kinases, and interferons.</p>

<p>LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR</p>

<p>FSD1L antibody was raised in Rabbit using Human FSD1L as the immunogen</p>

<p>The GPR4 antibody is a retinoid and HDAC inhibitor that belongs to the class of monoclonal antibodies. It is used in vaccine strains and has been shown to target β-catenin, collagen, and methyl transferase. This antibody is widely used in the field of life sciences and medicine for its nuclear properties. The GPR4 antibody specifically binds to Gynura procumbens and can be used as a tool for studying various cellular processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of antibodies.</p>

<p>Rabbit polyclonal ENTPD4 antibody</p>

<p>Rabbit polyclonal PLANH1 antibody (HRP)</p>

<p>TXNDC13 antibody was raised using the C terminal of TXNDC13 corresponding to a region with amino acids PGEDGVTREEVEPEEAEEGISEQPCPADTEVVEDSLRQRKSQHADKGL</p>

<p>The CD271 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets lipase, a key enzyme involved in lipid metabolism. This antibody is widely used in research to study the role of lipase in various biological processes. It has been shown to have high affinity and specificity for lipase, making it an ideal choice for experiments and assays.</p>

<p>PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI</p>

<p>Mouse monoclonal InfIuenza A Virus Nucleoprotein antibody</p>

<p>The Adenosine Deaminase antibody is a highly specialized biomolecule used in Life Sciences research. It is available as both a monoclonal and polyclonal antibody, making it versatile for various applications. This antibody specifically targets and binds to adenosine deaminase, an enzyme involved in the breakdown of adenosine.</p>

<p>Zkscan1 antibody was raised in rabbit using the C terminal of Zkscan1 as the immunogen</p>

<p>Purified recombinant THG1L protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf42 antibody, catalog no. 70R-3949</p>

<p>CNGA3 antibody was raised in Rabbit using Human CNGA3 as the immunogen</p>

<p>COPS8 antibody was raised in Rabbit using Human COPS8 as the immunogen</p>

<p>The S100A9 protein is a recombinant protein that is widely used in the field of life sciences. It plays a crucial role in various biological processes, including immune response, inflammation, and cell growth. This protein has been extensively studied and has shown to interact with other proteins such as fibronectin, collagen, and growth factors.</p>

<p>The alpha Synuclein antibody is a cytotoxic antibody commonly used in Life Sciences research. It specifically targets the phosphatase activity of alpha Synuclein dimers, which are known to be involved in various cellular processes. This antibody has been extensively studied and has shown high specificity and sensitivity in detecting alpha Synuclein autoantibodies in human serum samples. Additionally, it has been demonstrated to effectively neutralize the colony-stimulating factor activity of alpha Synuclein, suggesting its potential therapeutic applications in regulating immune responses. With its exceptional performance and versatility, the alpha Synuclein antibody is an essential tool for researchers studying the role of alpha Synuclein in different biological contexts.</p>

<p>Asrgl1 antibody was raised in rabbit using the C terminal of Asrgl1 as the immunogen</p>

<p>MCP2 antibody was raised in rabbit using highly pure recombinant murine MCP-2 (Mouse MCP-2) as the immunogen.</p>

<p>The TP53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes epidermal growth factor (EGF)-like growth factor, which plays a crucial role in cell proliferation and survival. This antibody is designed to bind with high affinity to EGF-like growth factors, preventing their interaction with receptors on the surface of cells.</p>

<p>DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV</p>

<p>Mouse monoclonal RPN1 antibody</p>

<p>Pf 04671536 hydrochloride is a peptide that blocks the binding of the natural ligand to its receptor. It has been used in research as a tool to study protein interactions and antibody-antigen reactions. Pf 04671536 hydrochloride is also used as an inhibitor or activator of ion channels and receptors, which are important in pharmacology and cell biology. This peptide is highly purified and can be used for research in many different fields.</p>

<p>Rabbit polyclonal OR13C8 antibody</p>

<p>GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA</p>

<p>EIF3S9 antibody was raised using the C terminal of EIF3S9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP</p>

<p>Mouse monoclonal RALBP1 antibody</p>

<p>CTDSPL2 antibody was raised in Rabbit using Human CTDSPL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF662 antibody, catalog no. 70R-9026</p>

<p>The CD40L antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically bind to CD40L, an important protein involved in immune responses. This antibody has been extensively studied and proven to be effective in various applications, including antiestrogen therapy.</p>

<p>Purified Polyclonal BCLW antibody</p>

<p>SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids  DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY</p>

<p>Purified Rabbit polyclonal DHRS4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATIC antibody, catalog no. 70R-1295</p>

<p>HNRNPF antibody was raised in Rabbit using recombinant human HNRNPF (2-154AA) as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYLC2 antibody, catalog no. 70R-2744</p>

<p>The CK18 antibody is a monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to CK18 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of CK18.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EEF1A1 antibody, catalog no. 70R-1029</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD34 antibody, catalog no. 70R-10220</p>

<p>Recombinant human PSAT1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHX15 antibody, catalog no. 70R-4690</p>

<p>The B71 antibody is a monoclonal antibody that plays a crucial role in various biological processes. It specifically targets the B7-1 protein, which is involved in immune responses and cell signaling. This antibody can be used in research and diagnostic applications to study the expression and function of B7-1. The B71 antibody has been widely used in the field of life sciences to investigate the role of B7-1 in diseases such as cancer, autoimmune disorders, and infectious diseases. Its high specificity and affinity make it an invaluable tool for researchers studying immune regulation and therapeutic development. Whether you're working on basic research or developing new therapies, the B71 antibody is an essential resource for your studies.</p>

<p>Mouse monoclonal Bt Cry1Ab/Ac antibody</p>

<p>CAPN7 antibody was raised in Rabbit using Human CAPN7 as the immunogen</p>

<p>CD40L antibody was raised in goat using highly pure recombinant human sCD40L as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XPO5 antibody, catalog no. 70R-8743</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PC antibody, catalog no. 70R-9828</p>

<p>CKAP4 antibody was raised using the middle region of CKAP4 corresponding to a region with amino acids SDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKE</p>

<p>PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids  FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS</p>

<p>Mouse monoclonal CD106 antibody (biotin)</p>

<p>Rabbit Polyclonal LDHAL6A antibody</p>

<p>BATF antibody was raised in Rabbit using Human BATF as the immunogen</p>

<p>ARL3 antibody was raised in Rabbit using Human ARL3 as the immunogen</p>

<p>The CD61 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to the CD61 protein, which is found on the surface of certain cells. This antibody has been extensively studied for its cytotoxic and nephrotoxic properties, making it a valuable tool for research purposes.</p>

<p>The ASS1 antibody is a monoclonal antibody that targets the argininosuccinate synthase 1 (ASS1) protein. This protein plays a crucial role in the production of arginine, an amino acid that is essential for various biological processes. The ASS1 antibody can be used in research and diagnostic applications to study the expression and localization of ASS1 in different tissues and cell types.</p>

<p>C20ORF100 antibody was raised in rabbit using the N terminal of C20ORF100 as the immunogen</p>

<p>Rabbit polyclonal SURF2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAOA antibody, catalog no. 70R-2464</p>

<p>Rabbit Polyclonal Catenin alpha antibody (Ser641)</p>

<p>The Parkin antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the Parkin protein, which plays a crucial role in cellular processes such as adiponectin regulation and growth factor signaling. This antibody has been extensively validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>Ketoprofen Conjugate for use in immunoassays</p>

<p>ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK</p>

<p>The SMS antibody is a highly specialized monoclonal antibody that has lysine-specific and neutralizing properties. This antibody targets the IFN-gamma growth factor, which plays a crucial role in regulating immune responses. By specifically binding to IFN-gamma, the SMS antibody can modulate its activity and potentially inhibit its effects.</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>TSLP antibody was raised in rabbit using highly pure recombinant human TSLP as the immunogen.</p>

<p>Ovalbumin protein is an interferon-inducing, acidic protein that is commonly used in Life Sciences research. It serves as a valuable tool for studying various cellular processes and functions. Ovalbumin has cytotoxic properties and can bind to specific proteins, making it useful in experiments involving antibody-drug conjugates and immunohistochemistry. Researchers often use ovalbumin as an antigen to generate antibodies for specific targets, such as transthyretin or CXCR4. This high-quality monoclonal antibody can then be used in various applications, including ELISA assays and Western blotting. With its versatility and reliability, ovalbumin protein is an essential component in many scientific studies.</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY</p>

<p>MSRA antibody was raised in Rabbit using Human MSRA as the immunogen</p>

<p>PF4V1 antibody was raised using the middle region of PF4V1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE</p>

<p>GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, hindering transcription and replication processes.</p>

<p>Phencyclidine piperidyl 4 Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal Annexin A2 antibody (HRP)</p>

<p>MAPKSP1 antibody was raised in Rabbit using Human MAPKSP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD3 antibody, catalog no. 70R-5060</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAPVD1 antibody, catalog no. 70R-2122</p>

<p>The LAT antibody is a neuroprotective agent that specifically targets catecholaminergic neurons. It has been extensively studied in the field of Life Sciences for its ability to activate and protect these neurons. The LAT antibody has shown to have a positive effect on cholinergic function and can enhance the production of interleukin-6, a growth factor involved in neuronal survival and regeneration. This antibody is produced by a hybridoma cell line and contains specific amino acid residues that allow it to bind to dopamine receptors. In addition, the LAT antibody has been found to have cytotoxic effects on certain cancer cells and can inhibit the activity of kinase substrates. It is commonly used in research laboratories and pharmaceutical companies for various applications related to neuroscience and immunology.</p>

<p>FZD7 antibody was raised in Rabbit using Human FZD7 as the immunogen</p>

<p>TNF alpha antibody is a monoclonal antibody that specifically targets TNF alpha, a protein involved in inflammation and immune response. This antibody is designed to bind to TNF alpha and inhibit its activity. It is composed of amino acid residues that are carefully selected to ensure high specificity and affinity for the target protein. TNF alpha antibody is a glycoprotein that has been activated and optimized for therapeutic use. Monoclonal antibodies like this one have been extensively researched and developed as potential cytotoxic inhibitors of TNF alpha. They have shown promising results in preclinical studies and are currently being evaluated in clinical trials for various inflammatory conditions. TNF alpha antibody can be used in research assays and also holds potential applications in the field of life sciences.</p>

<p>THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>The TPX2 antibody is a monoclonal antibody used in Life Sciences research as an inhibitor of morphogenetic protein. It is commonly used for gel extraction and clinical use in the field. This antibody specifically targets TPX2, a protein involved in cell division and growth regulation. By inhibiting TPX2, the antibody can effectively block certain cellular processes and pathways. The TPX2 antibody has been widely used in various studies, including immunohistochemical staining and gel chromatography experiments. Additionally, it has shown potential as a metallopeptidase inhibitor and urokinase-type plasminogen activator inhibitor. Researchers can rely on the high quality and specificity of this monoclonal antibody for their experiments and investigations in the field of Life Sciences.</p>

<p>SFT2D3 antibody was raised in rabbit using the N terminal of SFT2D3 as the immunogen</p>