Compuestos y reactivos bioquímicos

<p>Purified Rabbit polyclonal EPB41L2 antibody</p>

<p>The HDAC6 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the histone deacetylase 6 (HDAC6) protein, which plays a crucial role in the regulation of cell growth and division. By binding to HDAC6, this antibody exerts cytotoxic effects on cells, inhibiting their proliferation.</p>

<p>UGT3A2 antibody was raised using the N terminal of UGT3A2 corresponding to a region with amino acids HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM195 antibody, catalog no. 70R-6814</p>

<p>Rabbit polyclonal FBP2 antibody</p>

<p>MIP3 beta antibody was raised in mouse using highly pure recombinant human MIP-3 beta as the immunogen. This IgG1K antibody was purified from cell culture by Protein A affinity chromatography. as the immunogen.</p>

<p>Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD</p>

<p>The Foxj1 antibody is a neutralizing antibody that targets activated mesenchymal stem cells. It is commonly used in polymerase chain reactions and nuclear extracts for various research purposes in the field of biomaterials. This specific antibody binds to the response element-binding protein, forming a protein complex that plays a crucial role in collagen synthesis. The Foxj1 antibody is widely utilized in immunoassays and has been proven effective in detecting lectins and phosphorylation sites. If you're looking for high-quality antibodies for your life sciences research, the Foxj1 antibody is an excellent choice.</p>

<p>Purified recombinant CD34 protein (His tag)</p>

<p>The PARP2 antibody is a powerful tool for the quantitation and immobilization of PARP2, a glycoprotein involved in DNA repair. This monoclonal antibody specifically recognizes PARP2 and can be used for various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It has been extensively validated for its specificity and sensitivity in detecting PARP2 in human serum samples. The PARP2 antibody can also be used in combination with streptavidin-conjugated secondary antibodies for enhanced signal detection. With its high affinity and selectivity, this antibody is an essential tool for researchers studying DNA repair pathways, anti-angiogenesis therapies, and the development of PARP inhibitors for the treatment and/or prophylaxis of various diseases.</p>

<p>Purified Polyclonal NDUFA4 antibody</p>

<p>Rabbit polyclonal KPB1/2 antibody</p>

<p>DRAM antibody was raised in rabbit using the N terminal of DRAM as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYNC1I2 antibody, catalog no. 70R-4497</p>

<p>The GCG antibody is a monoclonal antibody that specifically targets the CD20 protein, a glycoprotein found on the surface of certain cells. This antibody-drug complex is designed to bind to the CD20 antigen, leading to the inhibition of cell growth and proliferation. The GCG antibody has shown promising results in the treatment of various diseases, including certain types of cancer and autoimmune disorders. It works by selectively targeting and destroying CD20-positive cells while sparing healthy cells. In addition to its therapeutic applications, this monoclonal antibody can also be used as a research tool for studying the role of CD20 in various biological processes. Its high specificity and affinity make it an invaluable tool for scientists and researchers working in the field of immunology.</p>

<p>Purified recombinant FCER1A protein (His tag)</p>

<p>KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KPTN antibody, catalog no. 70R-3023</p>

<p>Rabbit polyclonal PPFIA3 antibody</p>

<p>The WIF1 protein is a monoclonal antibody that belongs to the group of conjugated proteins. It has been shown to neutralize oncostatin, a growth hormone receptor inhibitory factor. This monoclonal antibody can specifically bind to autoantibodies and activate an antigen-antibody reaction. The WIF1 protein exhibits excellent photostability and can be used in various applications due to its emission properties. Its unique composition includes thiocyanate, which enhances its stability and efficacy.</p>

<p>FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF</p>

<p>SUZ12 antibody was raised in rabbit using the C terminal of SUZ12 as the immunogen</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>TCF23 antibody was raised in rabbit using the C terminal of TCF23 as the immunogen</p>

<p>The AQP1 antibody is a highly specialized monoclonal antibody that targets the aquaporin 1 protein. Aquaporin 1 is a transmembrane protein that facilitates the transport of water across cell membranes. This antibody has been extensively studied and shown to have a high affinity for aquaporin 1, making it an excellent tool for research in various fields such as life sciences.</p>

<p>FMNL2 antibody was raised in Rabbit using Human FMNL2 as the immunogen</p>

<p>The FKBP52 antibody is a highly specialized monoclonal antibody that has the ability to neutralize the effects of angptl3, a growth factor involved in adipose tissue regulation. This antibody can be used in various life sciences applications, such as research and diagnostics. It specifically targets FK506-binding protein 52 (FKBP52), which plays a crucial role in modulating protein phosphatase activity. The FKBP52 antibody can effectively inhibit the interaction between FKBP52 and its target proteins, thereby preventing downstream signaling events. It has been extensively tested and validated for use in various experimental settings, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays. With its high specificity and affinity for FKBP52, this antibody is an essential tool for researchers studying the complex mechanisms underlying cellular processes related to adipose tissue regulation and growth factor signaling pathways.</p>

<p>Rabbit polyclonal RAD51L3 antibody</p>

<p>The NNMT antibody is a highly specialized monoclonal antibody that targets the N-methylation of nicotinamide, an important metabolic process. This antibody specifically recognizes and binds to Nicotinamide N-Methyltransferase (NNMT), an enzyme involved in the regulation of various biological processes.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>Rabbit polyclonal PPP2R2B antibody</p>

<p>Mouse monoclonal HIF1A antibody</p>

<p>CNNM3 antibody was raised in Rabbit using Human CNNM3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KHDRBS1 antibody, catalog no. 70R-5677</p>

<p>The HKR2 antibody is a specific antibody that has been widely used in Life Sciences research. It is a monoclonal antibody that specifically recognizes and binds to the HKR2 protein, which is involved in various cellular processes. This antibody can be used in different applications such as laser ablation, flow assays, and chemiluminescent immunoassays.</p>

<p>CISD2 antibody was raised in Rabbit using Human CISD2 as the immunogen</p>

<p>JMJD2B antibody was raised using the middle region of JMJD2B corresponding to a region with amino acids SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV</p>

<p>The IL32 antibody is a polyclonal antibody that is commonly used in the field of life sciences. It is specifically designed to target and neutralize IL32, an important protein involved in various biological processes. This antibody can be used for research purposes, such as studying the role of IL32 in disease development or evaluating its therapeutic potential.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tigd4 antibody, catalog no. 70R-9206</p>

<p>GLRX2 antibody was raised in rabbit using the middle region of GLRX2 as the immunogen</p>

<p>CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ</p>

<p>TMEM16K antibody was raised using the C terminal of TMEM16K corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA</p>

<p>CRIP2 antibody was raised in Rabbit using Human CRIP2 as the immunogen</p>

<p>Collagen type VI antibody was raised in rabbit using collagen type VI from human and bovine placenta as the immunogen.</p>

<p>Rabbit polyclonal ZNF143 antibody</p>

<p>Rabbit polyclonal RPS2 antibody</p>

<p>PF-06297470 is a novel, potent and selective allosteric modulator of the metabotropic glutamate receptor type 1 (mGluR1). It has been shown to be orally active in animal models. This drug has been shown to have anti-Parkinsonian effects, which are related to its ability to inhibit glutamate release. PF-06297470 also inhibits the binding of glutamate to mGluR1 receptors, thereby inhibiting the activation of these receptors and reducing the transmission of excitatory signals in the brain. PF-06297470 binds with high affinity (Ki=0.5 nM) and selectivity to mGluR1 receptors, with no appreciable affinity for other metabotropic glutamate receptors or ion channels at concentrations up to 10 μM.</p>

<p>Recombinant Human MAP2K6 protein (His tag)</p>

<p>The MMAB antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been extensively studied and characterized using mass spectrometric methods. It has shown to have anticoagulant properties, making it a valuable asset in various research applications. One of the key features of the MMAB antibody is its ability to specifically bind to chemokines, which are important signaling molecules involved in immune responses. This allows researchers to study the role of chemokines in different biological processes. Moreover, this monoclonal antibody has been used for the detection and quantification of virus surface antigens. Its high specificity and sensitivity make it an ideal choice for studying viral infections and developing antiviral therapies. Additionally, the MMAB antibody has demonstrated neutralizing activity against certain viruses by inhibiting their replication. This makes it a promising candidate for the development of novel antiviral drugs. In conclusion, the MMAB antibody is a versatile tool with a wide range of applications in Life Sciences</p>

<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD</p>

<p>Rabbit anti-goat IgG (FITC) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

<p>EIF3S12 antibody was raised in mouse using recombinant Human Eukaryotic Translation Initiation Factor 3, Subunit 12 (Eif3S12)</p>

<p>Purified recombinant Human MORF4L1 Protein (His tag)</p>

<p>PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. This medication is highly effective in treating tuberculosis infections. It works by inhibiting bacterial growth through its ability to bind to DNA-dependent RNA polymerase, which prevents transcription and replication. Studies have shown its efficacy through patch-clamp techniques on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Recombinant human PPP1CA protein</p>

<p>The HSV1 protein is a trifunctional protein that belongs to the category of recombinant proteins and antigens. It has various roles in life sciences research, including acting as an electrode for experiments and studies. This protein has shown potential in anti-beta amyloid therapies, making it relevant in the field of neurodegenerative diseases such as Alzheimer's. Additionally, the HSV1 protein exhibits chemokine and growth factor properties, which can stimulate cellular responses and promote tissue growth. It interacts with tyrosine kinase receptors, activating pathways such as PI 3-kinase that play crucial roles in cell signaling. Furthermore, this protein has been studied for its genotoxic effects and its involvement in processes related to human serum, amyloid proteins, phosphatases, and alpha-fetoprotein. Its multifaceted nature makes the HSV1 protein a valuable tool for researchers exploring various aspects of molecular biology and disease mechanisms.</p>

<p>Rabbit polyclonal Beta Lactoglobulin antibody (biotin)</p>

<p>Purified Polyclonal STK17B antibody</p>

<p>The MAP2K2 antibody is a highly specific monoclonal antibody that targets the MAP2K2 protein. This antibody has been extensively validated for use in various applications in Life Sciences research. MAP2K2, also known as MEK2, is an important component of the MAP kinase signaling pathway and plays a crucial role in cell proliferation, differentiation, and survival.</p>

<p>MAP3K7IP2 antibody was raised in Rabbit using Human MAP3K7IP2 as the immunogen</p>

<p>Rabbit polyclonal PPP1R13L antibody</p>

<p>LHX5 antibody was raised in Rabbit using Human LHX5 as the immunogen</p>

<p>Rabbit polyclonal ABL1/2 antibody</p>

<p>Mouse monoclonal CD181 antibody</p>

<p>Itgb1 antibody was raised in rabbit using the C terminal of Itgb1 as the immunogen</p>

<p>Rabbit anti-mouse IgG3 was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4G3 antibody, catalog no. 70R-4871</p>

<p>SLC1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI</p>

<p>The Nav1.1 antibody is a powerful tool in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the Nav1.1 protein, which plays a crucial role in neuronal excitability. By binding to this protein, the Nav1.1 antibody inhibits the activation of glutamate receptors and enhances the activity of natriuretic peptide receptors, leading to a reduction in neuronal excitability.</p>

<p>C1ORF74 antibody was raised using the N terminal Of C1Orf74 corresponding to a region with amino acids ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>Peroxiredoxin 3 antibody was raised using the N terminal of PRDX3 corresponding to a region with amino acids AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS</p>

<p>Affinity purified Rabbit polyclonal TTC1 antibody</p>

<p>Rabbit Polyclonal eNOS antibody (Ser1176)</p>

<p>The Caspase 3 antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and detects the activated form of caspase 3, an enzyme involved in programmed cell death (apoptosis). This polyclonal antibody is designed to recognize and bind to caspase 3, allowing for its detection and analysis in various experimental settings.</p>

<p>IgG2a Negative Control Monoclonal Antibody BSA/Azide Free</p>

<p>AXUD1 antibody was raised in mouse using recombinant Human Axin1 Up-Regulated 1 (Axud1)</p>

<p>The CEA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied and proven effective in various applications, including antiestrogen therapy. This antibody specifically targets and binds to the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells.</p>

<p>Rabbit polyclonal OCRL antibody</p>

<p>Trpv6 antibody was raised in rabbit using the middle region of Trpv6 as the immunogen</p>

<p>SFRS2 antibody was raised in rabbit using the C terminal of SFRS2 as the immunogen</p>

<p>Purified recombinant CSNK1A1 protein (His tag)</p>

<p>GTF3C5 antibody was raised in Rabbit using Human GTF3C5 as the immunogen</p>

<p>Purified Polyclonal BATF2 antibody</p>

<p>Vitamin D3 Protein is a highly versatile supplement that offers numerous health benefits. It acts as an interferon and TNF-α growth factor, making it an essential component in Life Sciences research. This protein has neutralizing properties and can effectively bind to transferrin, ensuring optimal bioavailability.</p>

<p>Rabbit polyclonal TEKT1 antibody</p>

<p>Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria.<br>Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains.<br>Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines.<br>Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.</p>

<p>Purified Rabbit polyclonal MYB37 antibody</p>

<p>The Lactoferrin antibody is a powerful tool in the field of Life Sciences. It is a Monoclonal Antibody that specifically targets and binds to Lactoferrin, an iron-binding protein found in various biological fluids. This antibody has been extensively studied and proven to have high affinity and specificity for Lactoferrin.</p>

<p>Rabbit Polyclonal CA5B antibody</p>

<p>Calcitonin peptides are a group of proteins that play a vital role in the field of Life Sciences. These peptides have been extensively studied for their various applications, including electrospinning, glucagon regulation, retinoid metabolism, and more. With their unique structure consisting of amino acid residues, calcitonin peptides have shown potential as inhibitors for certain diseases. They have also been used in the development of Proteins and Antigens for immunoassays and other diagnostic applications.</p>

<p>Purified recombinant RPL30 protein (His tag)</p>

<p>C6ORF140 antibody was raised using the N terminal Of C6Orf140 corresponding to a region with amino acids NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPRED2 antibody, catalog no. 70R-10053</p>

<p>Mouse monoclonal Toll-like receptor 4 antibody (biotin)</p>

<p>TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen</p>

<p>Rabbit Polyclonal OR4B1 antibody</p>

<p>Purified Polyclonal CYP39A1 antibody</p>