Compuestos y reactivos bioquímicos

<p>ATL1 antibody was raised in Rabbit using Human ATL1 as the immunogen</p>

<p>The AT2 Receptor antibody is a monoclonal antibody used in Life Sciences. It is designed to target and neutralize the AT2 receptor, a polymorphic protein involved in various cellular processes. This antibody has been shown to have high affinity for the AT2 receptor and effectively block its activity. It can be used in research studies to investigate the role of the AT2 receptor in different biological pathways.</p>

<p>Rabbit polyclonal PRKAR2B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRKACB antibody, catalog no. 70R-9393</p>

<p>KCNK10 antibody was raised using the N terminal of KCNK10 corresponding to a region with amino acids EKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSA</p>

<p>Rabbit anti-bovine IgG (FITC) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.</p>

<p>ENTHD1 antibody was raised using the middle region of ENTHD1 corresponding to a region with amino acids RAIARLHEDLSTVIQELNVINNILMSMSLNSSQISQSSQVPQSSEGSSDQ</p>

<p>The CD122 antibody is a highly effective therapeutic tool that belongs to the class of activated monoclonal antibodies. It specifically targets CD122, a receptor for vasoactive intestinal peptide, which is involved in various physiological processes. This antibody has shown promising results in the treatment of autoimmune disorders, as it can neutralize autoantibodies and promote cytotoxic effects on target cells. Additionally, the CD122 antibody can be used in the development of chimeric receptors for immunotherapy purposes. With its high specificity and potency, this monoclonal antibody has gained significant attention in the field of Life Sciences. Its ability to induce necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated cell death makes it a valuable tool for cancer research and therapy. The CD122 antibody is derived from human monoclonal antibodies and has been extensively studied for its potential use in nuclear medicine, as well as its ability to enhance immune response and multidrug resistance.</p>

<p>Carboxypeptidase D antibody was raised using the N terminal of CPD corresponding to a region with amino acids SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPP</p>

<p>Rat monoclonal Toll-like receptor 9 antibody (PE)</p>

<p>Purified recombinant Human RAB27B protein</p>

<p>The PFKP antibody is a highly specialized monoclonal antibody that targets the PFKP protein. This protein plays a crucial role in various cellular processes, including chemokine signaling, cytotoxicity, and growth factor regulation. The PFKP antibody is designed to specifically bind to the PFKP protein, neutralizing its activity and preventing it from interacting with other molecules.</p>

<p>Purified Polyclonal MED18 antibody</p>

<p>Purified recombinant Human VRK3 Protein (His tag)</p>

<p>Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY</p>

<p>Rabbit polyclonal IL10Ra antibody (Tyr496)</p>

<p>Rabbit polyclonal RPL6 antibody</p>

<p>Recombinant human KPNA2 protein (His tag)</p>

<p>The FIR antibody is a polyclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the botulinum toxin, making it an essential tool for research and diagnostic purposes. This antibody has been extensively tested and proven to be highly effective in detecting and quantifying the presence of botulinum toxin in various samples. The FIR antibody can be used in combination with other monoclonal antibodies to enhance its cytotoxic effects, allowing for more accurate and reliable results. Its unique composition and high specificity make it an invaluable asset in the fight against botulinum toxin-related diseases. Additionally, this antibody has shown promising results as an anti-Mertk antibody, which makes it a potential candidate for developing novel therapies targeting Mertk family kinases. With its wide range of applications and exceptional performance, the FIR antibody is a must-have tool for any researcher or scientist working in the field of botulinum toxin research.</p>

<p>Rabbit polyclonal IKB alpha antibody (Ser32/Ser36)</p>

<p>Rabbit Polyclonal SAR1B antibody</p>

<p>FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT</p>

<p>Purified recombinant Human BCL10 Protein (His tag)</p>

<p>Rabbit polyclonal CD97 beta antibody (Ser531)</p>

<p>GNAI1 antibody was raised in Rabbit using Human GNAI1 as the immunogen</p>

<p>The FLT3 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to the FLT3 receptor, which plays a crucial role in cell growth and differentiation. This antibody has been extensively studied and proven to be highly effective in various research applications.</p>

<p>The CD172a antibody is a highly effective polyclonal antibody that promotes endothelial growth. It can also be used as a monoclonal antibody to detect the presence of CD172a in human serum. This antibody has been shown to inhibit the activity of interleukin-6, a cytokine involved in inflammation and immune response. Additionally, it has been found to bind to albumin, a protein found in the blood, and specifically target cardiomyocytes, which are heart muscle cells. The CD172a antibody activates mitogen-activated protein kinase kinase kinase (MAP3K), which is an important enzyme involved in cell signaling pathways. In summary, this antibody plays a crucial role in various life sciences applications by targeting specific proteins and regulating cellular processes through protein kinase activation.</p>

<p>Rabbit polyclonal KSR antibody (Ser392)</p>

<p>MEIS2 antibody was raised in Rabbit using Human MEIS2 as the immunogen</p>

<p>MAGEB18 antibody was raised in Rabbit using Human MAGEB18 as the immunogen</p>

<p>Rabbit polyclonal PRMT1 antibody (biotin)</p>

<p>The GPR110 antibody is a highly effective tool for targeting and inhibiting the activity of GPR110, a receptor that plays a crucial role in various cellular processes. This monoclonal antibody has been extensively studied and shown to effectively block the activation of GPR110, leading to a decrease in cortisol concentration and growth factor signaling.</p>

<p>FYB antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the potassium channel and acts as a drug antibody. FYB antibody has been extensively studied and validated for its application in various research techniques, including immunohistochemistry and in-situ assays. It is highly specific and shows excellent affinity towards its target.</p>

<p>Purified recombinant MYL12A protein</p>

<p>NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV</p>

<p>IL6 antibody was raised in goat using highly pure recombinant rat IL-6 as the immunogen.</p>

<p>Purified recombinant Human USP14 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GDE1 antibody, catalog no. 70R-7477</p>

<p>Purified recombinant RNF7 protein (His tag)</p>

<p>Complement C5b antibody was raised in mouse using activated human complement component C5 as the immunogen.</p>

<p>Mouse monoclonal NLN antibody</p>

<p>AFG3L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS</p>

<p>RUNDC2A antibody was raised in rabbit using the N terminal of RUNDC2A as the immunogen</p>

<p>GPN1 antibody was raised in Rabbit using Human GPN1 as the immunogen</p>

<p>DCX antibody was raised using a synthetic peptide corresponding to a region with amino acids PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR</p>

<p>KLHL8 antibody was raised in rabbit using the N terminal of KLHL8 as the immunogen</p>

<p>Purified recombinant EEF1G protein (His tag)</p>

<p>Factor I antibody was raised in Mouse using purified Factor I from human blood as the immunogen.</p>

<p>Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG</p>

<p>COX2 antibody is a polyclonal antibody that specifically targets cyclooxygenase-2 (COX-2), an enzyme involved in the production of inflammatory prostaglandins. This antibody is commonly used in research to study the role of COX-2 in various biological processes. It has been shown to be effective in detecting COX-2 expression in blood plasma and various tissues, including actin filaments and alpha-synuclein (α-syn). The COX2 antibody can be used for immunohistochemistry, Western blotting, and other applications to investigate the expression and localization of COX-2 in different cell types and tissues. Its high specificity and sensitivity make it a valuable tool for researchers studying the role of COX-2 in inflammation, cancer, and other diseases.</p>

<p>Introducing 6-Fluoro-3-indoxyl-beta-D-galactopyranoside: The Ultimate Antituberculosis Drug</p>

<p>Mouse monoclonal HSD17B10 antibody</p>

<p>The Myoglobin antibody is a highly specific and effective tool used in spectrometric and electrode-based assays. This Monoclonal Antibody has been developed to target the myoglobin protein, which plays a crucial role in oxygen storage and transport in muscle tissues. The Myoglobin antibody has been extensively tested and proven to have neutralizing properties against myoglobin, making it an ideal choice for research studies involving myoglobin-related processes.</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN</p>

<p>Purified recombinant MX2 protein (His tag)</p>

<p>Rabbit polyclonal RE57611p antibody</p>

<p>Rabbit polyclonal PSME3 antibody (FITC)</p>

<p>Purified Polyclonal TIN2 antibody</p>

<p>Purified Polyclonal ANT4 antibody</p>

<p>CHRNA5 antibody was raised in rabbit using the middle region of CHRNA5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL4 antibody, catalog no. 70R-2275</p>

<p>SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids  PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK</p>

<p>Rabbit polyclonal PKC theta antibody (Thr538)</p>

<p>Rabbit polyclonal RBMS1 antibody</p>

<p>HNF4A antibody was raised using the middle region of HNF4A corresponding to a region with amino acids LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI</p>

<p>(+)-CI 1044 is a potent synthetic compound that serves as a selective inhibitor of enzyme activity. It is derived through chemical synthesis, ensuring high purity and consistency. The compound exerts its effects by targeting specific enzymatic pathways, thereby altering the biochemical processes in targeted cells or tissues. This targeted inhibition is achieved through binding to the enzyme's active site, modulating its activity, and influencing downstream signaling pathways.</p>

<p>The CPA1 antibody is a highly reactive monoclonal antibody that is used in antiestrogen therapy. It specifically targets and binds to the fatty acid CPA1, inhibiting its activity. This antibody has been shown to block the interaction between CPA1 and interleukin-6, a growth factor involved in cancer cell proliferation. Additionally, the CPA1 antibody acts as a potent inhibitor of protein kinase activity, specifically targeting the CDK4/6 pathway. This makes it an effective tool for studying cell cycle regulation and potential therapeutic applications. With its high specificity and affinity, the CPA1 antibody is a valuable asset in life sciences research.</p>

<p>CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC</p>

<p>The AXL antibody is a highly specific monoclonal antibody that targets the AXL receptor tyrosine kinase. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been validated for use in multiple species and has shown high specificity and sensitivity.</p>

<p>Rabbit polyclonal EFNA2 antibody</p>

<p>The BRAF antibody is a highly potent monoclonal antibody that belongs to the group of chemokine antibodies. It exhibits strong cytotoxic and antitumor activity, making it an effective treatment for various types of cancer. This antibody specifically targets BRAF, a protein involved in cell growth and division, and neutralizes its function. By inhibiting BRAF, the antibody prevents the growth and spread of cancer cells.</p>

<p>Purified native Sheep Troponin I protein (Skeletal Muscle)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRPEL1 antibody, catalog no. 70R-2425</p>

<p>Purified Polyclonal UBB antibody</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>CIB2 antibody was raised in mouse using recombinant Human Calcium And Integrin Binding Family Member 2</p>

<p>WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS</p>

<p>1-158 amino acids: MGSSHHHHHH SSGLVPRGSH MAEQATKSVL FVCLGNICRS PIAEAVFRKL VTDQNISENW VIDSGAVSDW NVGRSPDPRA VSCLRNHGIH TAHKARQITK EDFATFDYIL CMDESNLRDL NRKSNQVKTC KAKIELLGSY DPQKQLIIED PYYGNDSDFE TVYQQCVRCC RAFLEKAH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPUL1 antibody, catalog no. 70R-1336</p>

<p>Mouse monoclonal MICAL1 antibody</p>

<p>FAM124A antibody was raised using the middle region of FAM124A corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HAMP antibody, catalog no. 70R-6236</p>

<p>TRIM32 antibody was raised in rabbit using the C terminal of TRIM32 as the immunogen</p>

<p>The CD83 antibody is a glycoprotein that acts as an anti-glial fibrillary acidic protein (GFAP) antibody. It is widely used in the field of Life Sciences for research purposes. This monoclonal antibody specifically targets GFAP, which is an acidic protein found in astrocytes, and it has been shown to be cytotoxic against cells expressing GFAP. In addition to its application in research, this antibody has also been used in diagnostic tests for the detection of autoantibodies, such as antiphospholipid antibodies and low-molecular-weight collagen antibodies. Its high specificity and affinity make it a valuable tool for various scientific applications.</p>

<p>TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an exceptional antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on human erythrocytes using a patch-clamp technique, demonstrating its high frequency of human activity. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The CD106 antibody is a monoclonal antibody that targets a cell surface antigen known as CD106. This antibody has been shown to have neutralizing effects on histidine, e-cadherin, and β-catenin. It is commonly used in research and diagnostic applications to study microvessel density and the activation of growth factors such as TGF-beta. The CD106 antibody can also be used to detect collagen in various tissues and is particularly useful for studying adipose tissue. With its high specificity and sensitivity, this antibody is an essential tool for researchers in the field of cell biology and immunology.</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>FLASH antibody was raised in rabbit using N terminus of the FLASH protein as the immunogen.</p>

<p>ATG3 antibody was raised in rabbit using the middle region of ATG3 as the immunogen</p>

<p>Please enquire for more information about 1-Methyl-4-propyl-1H-pyrrole-2-carboxaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal MRPL32 antibody</p>

<p>TLR8 antibody was raised in rabbit using the C terminal of TLR8 as the immunogen</p>

<p>Rabbit polyclonal p27Kip1 antibody (Thr187)</p>

<p>Mouse monoclonal HOXC11 antibody</p>

<p>Rabbit polyclonal ADRA1A antibody</p>

<p>The SMC3 antibody is a monoclonal antibody that targets the human protein SMC3. It is non-cytotoxic and specifically binds to SMC3 on the apical membrane. This antibody has been extensively characterized for its biochemical properties and has shown high specificity and affinity for SMC3. It has been used in various research applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The SMC3 antibody has also been used in studies investigating oxidative damage and reactive oxygen species (ROS) production. Additionally, this antibody has been evaluated as a potential therapeutic target for epidermal growth factor (EGF) signaling pathways and histone deacetylase inhibitors. Its amino-acid sequence has been well-documented, making it an essential tool for researchers studying protein-protein interactions and cellular processes involving SMC3.</p>

<p>PHF20L1 antibody was raised in rabbit using the N terminal of PHF20L1 as the immunogen</p>

<p>Purified Polyclonal CDYL2 antibody</p>