Compuestos y reactivos bioquímicos

<p>Sedative; anti-convulsant</p>

<p>Rabbit polyclonal CCR5 antibody (Ser349)</p>

<p>Region of EGF protein corresponding to amino acids MNSNTGCPPS YDGYCLNGGV CMYVESVDRY VCNCVIGYIG ERCQHRDLRW WKLR.</p>

<p>The Cathepsin S antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the activity of Cathepsin S, a proteolytic enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in studies involving mesenchymal stem cells, taxol, and other related compounds. It can be used for immobilization studies, as well as in vitro assays to measure enzyme activity. The Cathepsin S antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it an ideal tool for studying the role of Cathepsin S in various biological processes.</p>

<p>PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK</p>

<p>BMS-986020 is an inhibitor of the receptor tyrosine kinase, epidermal growth factor receptor (EGFR). The inhibition of EGFR has been shown to inhibit tumor cell proliferation and induce apoptosis. BMS-986020 is a high purity, water-soluble peptide that inhibits the growth of cancer cells in vitro by binding to the extracellular domain of EGFR. This drug may also be used as a research tool for studying protein interactions and antibody production.</p>

<p>Sabeluzole is a drug that is used to treat symptoms caused by excessive glutamate in the brain. It has been shown to be effective in the treatment of neuropathic pain and bowel disease. Sabeluzole is an analog of zolpidem, which is a sedative hypnotic drug that belongs to the class of pharmacological agents called imidazopyridines. This drug also has anti-inflammatory properties and has been found to be effective against inflammatory bowel disease, diabetic neuropathy, and fatty acid oxidation disorders.</p>

<p>RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF</p>

<p>Rabbit polyclonal PHYH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FHL5 antibody, catalog no. 70R-9097</p>

<p>Purified Polyclonal Cav3.1 antibody</p>

<p>SB 203580 hydrochloride is a p38 MAPK inhibitor that binds to the receptor site of the human serum albumin. It has been shown to have a significant effect on cell proliferation and cell migration in corneal endothelial cells and epidermal growth factor receptor-positive epithelial cells in culture. SB 203580 hydrochloride also inhibits protease activity, which may be related to its ability to inhibit tumor necrosis factor-α (TNF-α) production. SB 203580 hydrochloride is a nanoparticulate composition that can be used for treatment of inflammatory disorders such as asthma, COPD, and rheumatoid arthritis.</p>

<p>Purified recombinant Human PFDN4 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Aste1 antibody, catalog no. 70R-8231</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKMY2 antibody, catalog no. 70R-3728</p>

<p>Salusin-beta is a peptide that is used as a research tool for the study of ion channels and protein interactions. Salusin-beta inhibits potassium currents in cells, which may be due to its ability to bind to receptor sites on the cell membrane. It also inhibits the activity of protein kinase C and calcium channels. Salusin-beta has been shown to be an inhibitor of protein interactions, such as those between α-synuclein and synaptotagmin, which are involved in Parkinson's disease.</p>

<p>The SAA antibody is an anti-HER2 antibody-drug that targets the epidermal growth factor receptor (EGFR) pathway. It belongs to the class of monoclonal antibodies and is designed to inhibit the growth and proliferation of cancer cells. The SAA antibody specifically binds to HER2, a protein that is overexpressed in certain types of cancer, including breast cancer. By binding to HER2, the antibody prevents the activation of downstream signaling pathways that promote cell growth and survival. This targeted approach minimizes damage to healthy cells and reduces side effects associated with traditional chemotherapy drugs. The SAA antibody has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential as a treatment for HER2-positive cancers. With its high specificity and ability to block HER2 signaling, the SAA antibody represents a promising advancement in the field of targeted therapy for cancer.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL5 antibody, catalog no. 70R-4629</p>

<p>Rabbit Polyclonal eIF4G antibody (Ser1232)</p>

<p>Umbralisib hydrochloride is a research tool for the study of ion channels, peptides and proteins. It is a selective inhibitor of the human receptor PDGFRA, which has been shown to be essential for tumor growth in vitro.</p>

<p>E3 Ligase ligand 14 is a linker that binds to the E3 ubiquitin ligase, which selectively targets proteins for degradation. It is a chimeric molecule that consists of two parts: ubiquitin and an indoleamine. This linker has been shown to be active in metabolic disorders such as obesity and diabetes, as well as psychiatric disorders such as schizophrenia and depression. The linker can be used as a targeted drug or as a diagnostic tool in the identification of psychiatric conditions. E3 Ligase ligand 14 is also an inhibitor of the E3 ubiquitin ligase, which selectively targets proteins for degradation. It binds to the E3 ubiquitin ligase, which selectively targets proteins for degradation. It is a chimeric molecule that consists of two parts: ubiquitin and an indoleamine. This linker has been shown to be active in metabolic disorders such as obesity and diabetes, as well as psychiatric disorders such as schizophrenia and depression</p>

<p>Vasoactive Intestinal Peptide (VIP) Antiserum is a research tool that can be used to investigate the function of VIP in different cell types. VIP Antiserum is also an inhibitor of Protein interactions and may have applications in pharmacology.</p>

<p>Rabbit polyclonal PP2A alpha antibody (Tyr307)</p>

<p>The BECN1 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody specifically targets BECN1, a protein involved in various cellular processes such as autophagy, iron homeostasis, and tumor suppression. The polyclonal antibodies are derived from human serum and provide a broad range of reactivity to different epitopes of BECN1. On the other hand, the monoclonal antibody offers high specificity by targeting specific amino acid residues.</p>

<p>Cellulose synthase is a crucial enzyme involved in the synthesis of cellulose. Cellulose is an aggregation of unbranched polymer chains made of β-(1-4)-linked glucose residues, and is a component of primary and secondary cell walls - functioning to primarily maintain strength and shape in cells.Cellulose is synthesised by large cellulose synthase complexes (CSCs), which consist of synthase protein isoforms (CesA) that are arranged into a unique hexagonal structure.Specifically the isoform cellulose synthase 7 takes part in secondary cell wall cellulose synthesis.</p>

<p>FTI-277 hydrochloride is a small molecule inhibitor of farnesyltransferase, which is critical in the post-translational modification of proteins such as the Ras oncoproteins. Derived through meticulous chemical synthesis, this compound targets the enzymatic pathway responsible for the farnesylation of proteins, a key step for their localization and function within cell membranes.</p>

<p>PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV</p>

<p>HJC0197 is a chemical compound that is an analog of the amino acid L-glutamate. It has been shown to regulate camp levels, and has shown to be effective in treating diabetic neuropathy. HJC0197 is also used as a potentiator of anticancer drugs, such as cisplatin, by binding to the cation channel and mitochondrial membrane potential. HJC0197 induces the release of vasoactive intestinal polypeptide (VIP) in hematopoietic cells which leads to increased intracellular calcium concentration. HJC0197 activates toll-like receptor 4 and 5, which are receptors found on the surface of cells that bind to endotoxins and other molecular patterns associated with bacterial infection.</p>

<p>CNP-22 is a peptide that is an inhibitor of the protein interactions between the potassium channel Kv1.3 and its natural ligand, CNP-23, which is a member of the guanylate cyclase family of proteins. It has been shown to activate the potassium channel Kv1.2 in rat neurons, leading to increased neuronal excitability. CNP-22 has been used as a research tool for studying ion channels and receptors. The purified antibody can be used as an immunogen in preparing polyclonal or monoclonal antibodies against CNP-22.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CASP7 antibody, catalog no. 70R-9653</p>

<p>Syrian Hamster monoclonal NK cell antibody (PE)</p>

<p>YM 976 is a fatty acid that has been shown to have pharmacological effects on the bowel. YM 976 inhibits inflammatory bowel disease by binding to the fatty acid receptor, thereby inhibiting the production of proinflammatory mediators. This drug also has inhibitory effects on cyclic nucleotide phosphodiesterase and signal transduction pathways. It is also used for treating infectious diseases and autoimmune diseases because it inhibits transcription-polymerase chain reactions and inflammation. YM 976 also has hydroxyl groups that are involved in the inhibition of human macrophages, which may be related to its anti-inflammatory properties.</p>

<p>Affinity purified Rabbit polyclonal RAD1 antibody</p>

<p>GLPK protein is a glycoprotein that plays a crucial role in the Life Sciences field. It is widely used in the study of Proteins and Antigens, as well as in various research applications. GLPK protein has been found to have important functions in the immune system, including its involvement in the production of interferons and chemokines. It also exhibits antiviral properties, making it a valuable tool for studying viral infections.</p>

<p>Recombinant Human Tgm2 protein (His tag)</p>

<p>The CD27 antibody is a monoclonal antibody that specifically targets the CD27 molecule, a protein found on the surface of certain cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>8-Hexyloxy-3-(1H-tetrazol-5-yl)-2H-chromen-2-one is a potent, reversible inhibitor of the enzyme phosphodiesterase 4 (PDE4). It has been used to study protein interactions and as a research tool for studying ion channels and their function. 8-Hexyloxy-3-(1H-tetrazol-5-yl)-2H-chromen-2-one is also used as an antibody labeling agent to identify PDE4 in Western blotting.</p>

<p>Rabbit polyclonal NCAPH antibody</p>

<p>Collagen Type V protein is a neutralizing protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research as a native protein and antigen. Collagen Type V protein has been found to interact with ferritin, helicobacter proteins, olaparib, and growth factors such as TGF-beta and interleukin-6. This protein is involved in collagen synthesis and assembly, as well as regulating cellular signaling pathways. Additionally, Collagen Type V protein has been utilized for molecular docking studies and immobilization techniques in research settings. Its versatility and importance make it an essential component for studying various physiological and pathological processes.</p>

<p>Rabbit polyclonal MP68 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT9 antibody, catalog no. 70R-5105</p>

<p>METTL7A antibody was raised using the N terminal of METTL7A corresponding to a region with amino acids  MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN</p>

<p>STK39 antibody was raised using a synthetic peptide corresponding to a region with amino acids CAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVI</p>

<p>Affinity purified Rabbit polyclonal CCDC102B antibody</p>

<p>Carbovir-13C,d2 is a stable isotope-labeled compound, specifically a version of the antiviral agent carbovir, which is a nucleoside analog. This labeled compound is derived through the incorporation of carbon-13 and deuterium atoms within the molecular structure of carbovir, a process typically achieved via synthetic organic chemistry techniques. Such isotopic labeling enables more precise investigation into the compound's pharmacokinetics and metabolic pathways.</p>

<p>Purified recombinant Human DNAJC19 protein</p>

<p>Purified recombinant CPEB1 protein (His tag)</p>

<p>Recombinant Cat Troponin I (TNNI3) Protein is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Recombinant Cat Troponin I Protein including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.</p>

<p>MLLT3 antibody was raised in Rabbit using Human MLLT3 as the immunogen</p>

<p>Mouse monoclonal CD40 antibody (FITC)</p>

<p>The TRIM23 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets chemokines and autoantibodies, making it an essential component in various experiments and assays. It has been extensively tested and proven to effectively neutralize interferon-gamma (IFN-gamma) and growth factors, allowing for accurate measurements and analysis. Additionally, the TRIM23 antibody has demonstrated high affinity towards human folate, actin filaments, taxol, and alpha-fetoprotein, making it a versatile option for a wide range of applications. With its exceptional specificity and reliability, this polyclonal antibody is an invaluable asset for any laboratory or research facility. Trust the TRIM23 antibody to deliver consistent results and advance your scientific endeavors.</p>

<p>Itga7 antibody was raised in rabbit using the N terminal of Itga7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MSH4 antibody, catalog no. 70R-5617</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA6 antibody, catalog no. 70R-3951</p>

<p>Recombinant Dog Troponin I (TNNI3) Protein is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Recombinant Dog Troponin I Protein including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Region of Oncostatin M protein corresponding to amino acids MAAIGSCSKE YRVLLGQLQK QTDLMQDTSR LLDPYIRIQG LDVPKLREHC RERPGAFPSE ETLRGLGRRG FLQTLNATLG CVLHRLADLE QRLPKAQDLE RSGLNIEDLE KLQMARPNIL GLRNNIYCMA QLLDNSDTAE PTKAGRGASQ PPTPTPASDA FQRKLEGCRF LHGYHRFMHS VGRVFSKWGE SPNRSRRHSP HQALRKGVRR.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC27A5 antibody, catalog no. 70R-7500</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC30A1 antibody, catalog no. 70R-7370</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TK2 antibody, catalog no. 70R-10316</p>

<p>Rabbit polyclonal TULP3 antibody</p>

<p>Chicken polyclonal MTBE antibody</p>

<p>CYP21A2 antibody was raised in rabbit using the C terminal of CYP21A2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAP1 antibody, catalog no. 70R-5960</p>

<p>Recombinant Human NuBP1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA6 antibody, catalog no. 70R-3829</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of METAP1 antibody, catalog no. 70R-2201</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARPC3 antibody, catalog no. 70R-3073</p>

<p>FHIT protein is a crucial protein involved in protecting cells from oxidative damage caused by intracellular reactive oxygen species. It plays a significant role in maintaining the integrity of the genome and preventing DNA damage. FHIT protein can be detected using immunohistochemical techniques, which allow for visualizing its presence within tissues. This detection method relies on the use of specific monoclonal antibodies that bind to FHIT protein with high specificity.</p>

<p>G10 antibody was raised in mouse using recombinant Human Maternal G10</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STATH antibody, catalog no. 70R-5453</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAZAP1 antibody, catalog no. 70R-1355</p>

<p>The DHFR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various proteolytic processes and is commonly used in immunoassays to detect and quantify the presence of DHFR protein. This antibody specifically targets and binds to the DHFR enzyme, inhibiting its activity and preventing the conversion of dihydrofolate to tetrahydrofolate. By doing so, it disrupts essential cellular processes such as DNA synthesis, repair, and methylation. The DHFR antibody has also been shown to activate the p38 mitogen-activated protein kinase pathway and induce endonuclease activity in certain cell types. Its acidic nature allows for efficient penetration into cells and binding to nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) transcription factors, influencing gene expression patterns. Researchers rely on the high specificity and sensitivity of this monoclonal antibody for accurate analysis of DHFR-related pathways and understanding its role in growth regulation</p>

<p>Goat anti-mouse IgG (Fab'2) (PE) was raised in goat using murine IgG F(ab’)2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK13 antibody, catalog no. 70R-5668</p>

<p>The GAPDH Blocking Peptide is a powerful tool used in Life Sciences research. It is a ligase that acts as a blocking peptide for glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This peptide specifically inhibits the activity of GAPDH, an essential enzyme involved in glycolysis and other cellular processes. By blocking the function of GAPDH, researchers can study the impact of its inhibition on various cellular pathways and processes. The GAPDH Blocking Peptide is widely used in biochemical and molecular biology studies, providing valuable insights into the role of this enzyme in cellular functions. With its high quality and effectiveness, this peptide is a valuable addition to any research project in the field of Life Sciences.</p>

<p>The RLBP1 antibody is a monoclonal antibody that targets RLBP1, a protein involved in the regulation of microvessel density. This antibody acts as an anticoagulant by binding to RLBP1 and inhibiting its function. It has been shown to reduce fibrinogen levels and inhibit the production of acidic TNF-α, a growth factor involved in inflammation. Additionally, the RLBP1 antibody has been found to have multidrug properties, as it can bind to and neutralize the effects of various antibodies such as adalimumab. Its mechanism of action involves targeting activated nuclear receptors and modulating their activity. With its unique characteristics, the RLBP1 antibody offers potential therapeutic applications in the field of vascular biology and inflammation research.</p>

<p>LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIP6 antibody, catalog no. 70R-9086</p>

<p>The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC8B antibody, catalog no. 70R-3670</p>

<p>HBsAg Recombinant Protein, Subtype adr is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HBsAg Recombinant Protein, Subtype adr including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Anti GLP-1 (7-36)-NH₂, human serum is a recombinant protein that inhibits the activity of the glucagon-like peptide-1 receptor. It is used as a research tool to study the role of GLP-1 and its receptor in regulating blood glucose levels. Anti GLP-1 (7-36)-NH₂, human serum can be used as a ligand for the isolation of the GLP-1 receptor from cells. The anti GLP-1 (7-36)-NH₂, human serum is also used to study ion channels and antibody binding.</p>

<p>Purified recombinant Human PFDN6 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRLF1 antibody, catalog no. 70R-5737</p>

<p>Purified recombinant Human NKIRAS1 protein (His tag)</p>

<p>POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal GLYATL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ttbk2 antibody, catalog no. 70R-8045</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf24 antibody, catalog no. 70R-3887</p>

<p>FAM71D antibody was raised using the middle region of FAM71D corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX50 antibody, catalog no. 70R-1367</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ECHDC2 antibody, catalog no. 70R-5270</p>

<p>Purified recombinant Human SULT1B1 Protein (His tag)</p>

<p>human IgE from myelomatous human serum.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BLVRB antibody, catalog no. 70R-2179</p>

<p>INSR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDF4 antibody, catalog no. 70R-7410</p>

<p>DGAT2L4 antibody was raised using the C terminal of DGAT2L4 corresponding to a region with amino acids GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII</p>

<p>Rabbit polyclonal Ubinuclein antibody</p>