Compuestos y reactivos bioquímicos

<p>The Trazodone antibody is a reactive monoclonal antibody that falls under the category of Life Sciences. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α) and interleukin (IL), which are key inflammatory factors in the body. This antibody has shown inhibitory effects on adipose tissue and chemokine production, making it a potential therapeutic option for conditions associated with inflammation and immune dysregulation. Additionally, the Trazodone antibody has been found to have neutralizing activity against Brucella abortus, a bacterium that causes brucellosis in animals and humans. This suggests its potential use in treating infections caused by this pathogen. Furthermore, this antibody exhibits inhibitory effects on family kinase inhibitors and calmodulin, which are involved in various cellular processes such as signal transduction and calcium signaling. By targeting these proteins, the Trazodone antibody may have implications for the treatment of diseases related to their dys</p>

<p>KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK</p>

<p>MPPED1 antibody was raised in Rabbit using Human MPPED1 as the immunogen</p>

<p>Marcks antibody was raised in Rabbit using Human Marcks as the immunogen</p>

<p>Purified recombinant UBE2Z protein (His tag)</p>

<p>The p70S6K antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of p70S6K, an important protein involved in cell signaling pathways. This antibody has been extensively tested and validated for use in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>EEF1G antibody was raised using the middle region of EEF1G corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE</p>

<p>C13ORF31 antibody was raised using the middle region of C13Orf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN</p>

<p>Rabbit polyclonal RAB4A antibody</p>

<p>The p53 antibody is a monoclonal antibody that specifically targets the p53 protein, a key regulator of cell growth and division. This antibody is widely used in Life Sciences research for various applications, including immunohistochemical detection and Western blot analysis. The p53 antibody recognizes the carboxy-terminal region of the p53 protein, which includes the tetramerization domain. It has been shown to be highly specific and sensitive in detecting p53 expression levels in human serum samples, making it a valuable serum marker for various diseases and conditions. Additionally, this antibody can also be used to study the role of p53 in different cellular processes, such as apoptosis and DNA repair. Its high affinity and specificity make it an essential tool for researchers studying protein kinases and epidermal growth factor signaling pathways.</p>

<p>Affinity purified Rabbit polyclonal GIMAP8 antibody</p>

<p>PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG</p>

<p>HEY2 antibody was raised in Rabbit using Human HEY2 as the immunogen</p>

<p>Hey1 antibody was raised in rabbit using the C terminal of Hey1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCN5A antibody, catalog no. 70R-5111</p>

<p>GNE-9605 is a small molecule that is structurally unrelated to any other known kinase inhibitors. It has been shown to bind to and inhibit the activity of the GNE-9605 enzyme with high selectivity, which has been shown to be expressed in cells in vitro. Studies have also shown that this molecule can cross the blood brain barrier and accumulate in tissues such as the brain, spinal cord, and retina. GNE-9605 has been shown to have neuroprotective effects on cellular function by inhibiting the GNE-9605 enzyme.</p>

<p>Purified recombinant ATP5C1 protein (His tag)</p>

<p>Glutamate dehydrogenase antibody was raised in rabbit using glutamate dehydrogenase isolated from bovine liver as the immunogen.</p>

<p>Elastin antibody is a highly specialized adeno-associated monoclonal antibody that targets elastin, an important protein found in connective tissues. It is commonly used in the field of Life Sciences for research purposes. Elastin antibody specifically binds to elastin molecules and can be used to study their distribution and function in various biological processes. This antibody has been extensively validated and is widely recognized for its high specificity and sensitivity. It can be used in a variety of applications, including immunohistochemistry, Western blotting, and ELISA assays. With its unique properties, Elastin antibody is an essential tool for researchers studying the role of elastin in different physiological and pathological conditions.</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>INTS10 antibody was raised in Rabbit using Human INTS10 as the immunogen</p>

<p>DPP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>JNK inhibitor VIII is a potent, selective and cell-permeable JNK inhibitor that is effective in inhibiting the activation of pro-inflammatory genes. It has been shown to inhibit the proliferation and induce apoptosis in leukemia cells, as well as blocking the growth of primary human prostate cancer cells. JNK inhibitor VIII blocks ubiquitin ligases involved in protein degradation and mitochondrial membrane potential, which induces reactive oxygen species (ROS) production by mitochondria. This leads to an increase in cytosolic Ca2+, c-jun phosphorylation, and potential drug target for cancer therapy.</p>

<p>IRGC antibody was raised in Rabbit using Human IRGC as the immunogen</p>

<p>Rabbit polyclonal Seed G28 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF138 antibody, catalog no. 70R-8721</p>

<p>The MZF1 antibody is a monoclonal antibody that specifically targets and binds to the MZF1 protein. This protein is involved in various cellular processes, including the regulation of gene expression and cell differentiation. The MZF1 antibody can be used in research and diagnostic applications to study the role of MZF1 in different biological systems.</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal CKMT1 antibody</p>

<p>Mouse monoclonal CST3 antibody</p>

<p>PAPSS2 antibody was raised using the C terminal of PAPSS2 corresponding to a region with amino acids PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN</p>

<p>RUVBL1 antibody was raised in mouse using recombinant Human Ruvb-Like 1 (E. Coli) (Ruvbl1)</p>

<p>TRIM17 antibody was raised in rabbit using the middle region of TRIM17 as the immunogen</p>

<p>The NFKB1 antibody is a powerful tool used in Life Sciences research. It specifically targets the NFKB1 gene, which is an oncogene homolog involved in various cellular processes. This monoclonal antibody has been extensively validated and is widely used in bioassays to study the function and regulation of NFKB1.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTT1 antibody, catalog no. 70R-2157</p>

<p>TNF Receptor 1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize the activity of TNF receptor 1, a cell surface protein involved in various cellular processes. This antibody acts as a potent inhibitor of TNF receptor 1 signaling, which plays a crucial role in inflammation and immune response. The TNF Receptor 1 antibody has been extensively studied and proven to be effective in inhibiting the growth factor-induced activation of downstream pathways. It has also shown promising results in preclinical studies targeting diseases such as cancer and autoimmune disorders. With its high specificity and cytotoxic properties, this antibody holds great potential for therapeutic applications in targeted therapy. Whether used alone or in combination with other antibodies such as anti-VEGF or tyrosinase inhibitors, TNF Receptor 1 antibody offers a promising avenue for researchers and clinicians alike in their quest to combat various diseases effectively.</p>

<p>Lipoprotein Lipase Monoclonal Antibody Biotin</p>

<p>The LGR4 antibody is a powerful tool in the field of life sciences. It is a cytotoxic antibody that specifically targets and binds to LGR4, a histidine-rich receptor protein. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry.</p>

<p>RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>Rat monoclonal T and B cell activation antigen antibody</p>

<p>Plectin antibody was raised in guinea pig using the C-Terminal “C” domain of recombinant human plectin as the immunogen.</p>

<p>Purified recombinant IL36G protein (His tag)</p>

<p>Mouse monoclonal TAF2 antibody</p>

<p>SLC9A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids INYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQT</p>

<p>Rabbit polyclonal SF3B2 antibody</p>

<p>The IgM antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets the molecule called mesothelin, which is found in the nucleus of cells. This antibody has cytotoxic properties and can effectively neutralize the urokinase plasminogen activator, which plays a role in cell migration and invasion.</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>CYP3A7 antibody was raised using the middle region of CYP3A7 corresponding to a region with amino acids KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG</p>

<p>Armenian Hamster monoclonal CD119 antibody (PE)</p>

<p>Mouse monoclonal CD3 antibody (biotin)</p>

<p>CD44 Monoclonal Antibody (FITC)</p>

<p>GPR151 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.</p>

<p>Rabbit polyclonal AP2A1 antibody</p>

<p>HAAO antibody was raised using the N terminal of HAAO corresponding to a region with amino acids HRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVG</p>

<p>The VASP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor (EGF)-like domain of VASP (Vasodilator-stimulated phosphoprotein), a protein involved in cell adhesion and migration. This antibody has been extensively characterized and validated for its high specificity and affinity towards VASP.</p>

<p>Rabbit polyclonal NR2C1 antibody</p>

<p>Rabbit polyclonal GPR62 antibody</p>

<p>The IL17F antibody is a powerful tool in the field of Life Sciences. It is specifically designed to target and neutralize the effects of IL17F, an important cytokine involved in various inflammatory processes. This antibody has been extensively tested and proven to effectively block IL17F activity, making it a valuable asset in research and therapeutic applications.</p>

<p>The EpCAM antibody is a monoclonal antibody that has been developed through recombinant technology. It specifically targets the epithelial cell adhesion molecule (EpCAM), which is expressed on the surface of various types of cancer cells. By binding to EpCAM, this antibody inhibits the growth and spread of cancer cells.</p>

<p>Mouse monoclonal XRCC1 antibody</p>

<p>PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV</p>

<p>Chlamydia pneumoniae antibody was raised in Mouse using Chlamydia pneumoniae (TWAR) as the immunogen.</p>

<p>ATP6V1B1 antibody was raised using the middle region of ATP6V1B1 corresponding to a region with amino acids LMKSAIGEGMTRKDHGDVSNQLYACYAIGKDVQAMKAVVGEEALTSEDLL</p>

<p>The AKT1 antibody is a highly effective colloidal solution that contains monoclonal antibodies. These antibodies specifically target and bind to the AKT1 protein, which plays a crucial role in various cellular processes. By binding to AKT1, the antibody inhibits its activity and prevents the activation of downstream signaling pathways.</p>

<p>Purified recombinant Human CHI3L1 protein (His tag)</p>

<p>Purified native Bovine Factor X protein</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an advanced antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has been conducted on this drug using advanced techniques like the patch-clamp technique on human erythrocytes, proving its high efficacy in combating tuberculosis. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>CD11/CD18 Monoclonal Antibody</p>

<p>GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDI</p>

<p>PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>The Beta galactosidase antibody is a neutralizing antibody used in Life Sciences research. It specifically targets and binds to the glycan structure of Beta galactosidase, an enzyme involved in glycosylation processes. This antibody is commonly used in biochemical studies to analyze the function and localization of Beta galactosidase in cells and tissues.</p>

<p>Rabbit polyclonal RIC8B antibody</p>

<p>Purified Polyclonal CSNK1G1 antibody</p>

<p>KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG</p>

<p>Rabbit polyclonal FHIT antibody (FITC)</p>

<p>LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV</p>

<p>The L1CAM antibody is a monoclonal antibody that has been specifically designed to target and bind to the L1 cell adhesion molecule. This molecule is found on the surface of various cells, including endothelial cells, and plays a crucial role in cell adhesion, migration, and signaling. The L1CAM antibody has been shown to be highly effective in inhibiting the activation of L1CAM and preventing its interaction with other molecules such as glutamate binding proteins, chemokines, fatty acids, collagen, and other biomolecules.</p>

<p>Mouse monoclonal Oncostatin M receptor antibody (PE)</p>

<p>The TP53 antibody is a monoclonal antibody used in life sciences research. It specifically targets the TP53 protein, also known as p53, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody has been extensively studied in various applications, including the detection of TP53 mutations in cancer cells and the investigation of its interaction with other proteins.</p>

<p>Armenian Hamster monoclonal CD40 antibody (FITC)</p>

<p>Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal LKB1 antibody (Ser428)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF589 antibody, catalog no. 70R-8218</p>

<p>GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI</p>

<p>Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ</p>

<p>Rabbit polyclonal CXG2 antibody</p>

<p>Purified recombinant Human BCL2L11 protein (His tag)</p>

<p>ZNF101 antibody was raised in rabbit using the N terminal of ZNF101 as the immunogen</p>

<p>Purified Polyclonal SH3GLB2 antibody</p>

<p>SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Mouse monoclonal FAHD2A antibody</p>

<p>Mouse monoclonal SBDS antibody</p>

<p>Mouse monoclonal PP1A antibody</p>

<p>CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.</p>

<p>ABHD2 antibody was raised using the middle region of ABHD2 corresponding to a region with amino acids RESHTHRDRPSQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADR</p>