Compuestos y reactivos bioquímicos

<p>The CNP antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets insulin and adipocyte-related proteins, making it an invaluable tool for researchers studying these areas. This polyclonal antibody has been developed to detect and measure the levels of superoxide, fatty acids, interferon, and e-cadherin expression in various samples. Its high specificity and sensitivity make it ideal for use in experiments investigating the role of insulin in adipose tissue and its effects on other cellular processes. Whether you are studying metabolic disorders or exploring new therapeutic approaches, the CNP antibody can provide valuable insights into the intricate mechanisms underlying these conditions. Trust this reliable antibody to deliver accurate and reproducible results for your research needs.</p>

<p>Rabbit polyclonal CEB beta antibody</p>

<p>Purified Polyclonal MAST4 antibody</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1995</p>

<p>Rabbit polyclonal SLC25A2 antibody</p>

<p>Rabbit polyclonal TNPO1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Rabbit polyclonal p57 Kip2 antibody (Thr310)</p>

<p>KI67 antibody was raised in rabbit using synthetic peptide derived from human Ki-67 protein as the immunogen.</p>

<p>Purified recombinant RPAIN protein (His tag)</p>

<p>Purified Rabbit polyclonal ADRB2 antibody (Ser346)</p>

<p>Purified native Minute Virus of Mice protein (Mouse)</p>

<p>ZNF322A antibody was raised in rabbit using the C terminal of ZNF322A as the immunogen</p>

<p>A lid covering the substrate 508-638 amino acids: MNEDEIQKMV RDAEANAEAD RKFEELVQTR NQGDHLLHST RKQVEEAGDK LPADDKTAIE SALTALETAL KGEDKAAIEA KMQELAQVSQ KLMEIAQQQH AQQQTAGADA SANNAKDDDV VDAEFEEVKD KK</p>

<p>Purified recombinant COMMD6 protein (His tag)</p>

<p>The p53 antibody is an extracellular antigen that specifically targets the p53 protein. This antibody is widely used in research and diagnostics to detect and quantify the presence of p53 in various samples. It can be used in immunohistochemistry, Western blotting, and ELISA assays. The p53 antibody is available as both polyclonal antibodies and monoclonal antibodies, offering researchers a range of options for their experiments. Additionally, this antibody can be used to study the role of p53 in different cellular processes, including apoptosis, cell cycle regulation, and DNA repair. With its high specificity and sensitivity, the p53 antibody is an essential tool for scientists working in life sciences and related fields.</p>

<p>Rabbit polyclonal Orosomucoid antibody (HRP)</p>

<p>The CD10 antibody is a monoclonal antibody that is used in Life Sciences research. It is commonly used as an inhibitor and immobilized to study the function and expression of CD10, also known as neprilysin. CD10 is a glycoprotein that plays a crucial role in various biological processes, including cell migration, chemokine regulation, and antigen processing.</p>

<p>TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR</p>

<p>The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal IFN beta antibody (biotin)</p>

<p>SLC22A15 antibody was raised using the middle region of SLC22A15 corresponding to a region with amino acids NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK</p>

<p>TOP2B antibody was raised in rabbit using the middle region of TOP2B as the immunogen</p>

<p>Mouse monoclonal MKI67 antibody</p>

<p>SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL</p>

<p>STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIK</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective rifamycin for treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has proven its high activity in human erythrocytes using a patch-clamp technique. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>AFP antibody was raised against Human Alfafetoprotein (AFP).</p>

<p>ZBTB2 antibody was raised in rabbit using the middle region of ZBTB2 as the immunogen</p>

<p>SLCO1A2 antibody was raised in rabbit using the middle region of SLCO1A2 as the immunogen</p>

<p>Rabbit polyclonal SNX19 antibody</p>

<p>Rabbit polyclonal WFDC2 antibody (HRP)</p>

<p>SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK</p>

<p>CD1d antibody is a monoclonal antibody that targets CD1d, a protein involved in immune responses. It has been shown to have potential therapeutic applications in various fields of life sciences. CD1d antibody can be used for research purposes, such as studying the role of CD1d in immune system function and identifying potential therapeutic targets for diseases like choroidal neovascularization and cryptosporidium infection. Additionally, this antibody can be utilized in nuclear assays to detect and analyze the expression of CD1d in different cell types. The use of CD1d antibody provides researchers with a valuable tool to further understand the complex mechanisms of immune response and develop innovative treatments.</p>

<p>Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>Rabbit polyclonal RUFY2 antibody</p>

<p>Purified recombinant POP4 protein (His tag)</p>

<p>ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>SIRT1 antibody was raised in Mouse using a purified recombinant fragment of human SIRT1 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal PTPRE antibody</p>

<p>Mouse brain antibody (FITC) was raised in rabbit using brain tissue from Balb/c mice as the immunogen.</p>

<p>The HDAC1 antibody is a highly specialized antibody that is used for various research purposes. It is commonly used in studies involving human serum, electrode, casein, and inhibitory factors. This antibody specifically targets the HDAC1 protein, which is an important enzyme involved in gene regulation. The HDAC1 antibody can be used in both monoclonal and polyclonal forms, depending on the specific research needs. It is a glycoprotein that binds to the HDAC1 protein with high affinity, allowing for accurate detection and analysis. Researchers can use this antibody to study various aspects of gene expression, including messenger RNA levels and oncostatin signaling pathways. The HDAC1 antibody is produced using advanced techniques that ensure high specificity and sensitivity. It contains primary amino acids and cysteine disulfide bonds that contribute to its stability and effectiveness. Whether you are studying gene regulation or conducting experiments in molecular biology, the HDAC1 antibody is an essential tool for your research endeavors.</p>

<p>The Myogenin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize the alpha-fetoprotein, which is a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be highly effective in binding to the alpha-fetoprotein, making it an essential tool for researchers studying its function and potential therapeutic applications.</p>

<p>Purified native Mouse Haptoglobin protein</p>

<p>Rabbit polyclonal HXA5 antibody</p>

<p>The beta Catenin antibody is a growth factor that belongs to the class of antibodies. It acts as an inhibitor, blocking the action of other antibodies and chemokines. In the field of Life Sciences, this monoclonal antibody is widely used as a test compound for various experiments. It specifically targets beta catenin, a nuclear protein involved in cell signaling and adhesion. This antibody has a neutralizing effect on beta catenin, preventing its interaction with other proteins and inhibiting downstream signaling pathways. Additionally, it has been shown to inhibit endothelial growth and interfere with interferon-gamma (IFN-gamma) signaling. The beta Catenin antibody is an essential tool for researchers in the field of Life Sciences looking to study and manipulate cellular processes involving beta catenin.</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>Mouse monoclonal IFT57 antibody</p>

<p>Purified Polyclonal CRHR1 antibody</p>

<p>GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fxn antibody, catalog no. 70R-8779</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR1D antibody, catalog no. 70R-2039</p>

<p>Lidocaine antibody was raised in mouse using lidocaine conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal RANBP9 antibody</p>

<p>ZNF491 antibody was raised in rabbit using the N terminal of ZNF491 as the immunogen</p>

<p>Rabbit polyclonal SENP8 antibody</p>

<p>Mouse monoclonal AMPKa1 antibody (N-terminus)</p>

<p>Rabbit polyclonal THBS3 antibody</p>

<p>Purified Parainfluenza type 2 protein</p>

<p>The HSP25 antibody is a monoclonal antibody that specifically targets the antigen HSP25. This antibody is widely used in the field of life sciences for various applications, including research and diagnostics. The HSP25 antibody can be used to detect and quantify the levels of HSP25 in different samples, such as human serum or cell lysates. It can also be used in immunohistochemistry and immunofluorescence experiments to visualize the localization of HSP25 within cells or tissues. Additionally, this antibody has been utilized in studies investigating the role of HSP25 in various biological processes, such as its interaction with TGF-beta signaling pathways or its involvement in helicobacter infections. With its high specificity and sensitivity, the HSP25 antibody is an essential tool for researchers studying protein-protein interactions or exploring potential therapeutic targets.</p>

<p>Rabbit polyclonal TOM70 antibody</p>

<p>Recombinant Human CHST10 protein (His tag)</p>

<p>RABGGTA antibody was raised using the N terminal of RABGGTA corresponding to a region with amino acids ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL</p>

<p>LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV</p>

<p>CCNF antibody was raised in mouse using recombinant Human Cyclin F (Ccnf)</p>

<p>RANKL antibody was raised in goat using highly pure recombinant human sRANKL as the immunogen.</p>

<p>The CBL antibody is a highly specialized antibody used in the field of life sciences. It is a polyclonal antibody that targets dopamine and progesterone, among other molecules. This antibody has the unique ability to neutralize these substances, making it an essential tool for research and experimentation. The CBL antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting. Its high specificity and sensitivity ensure accurate and reliable results. Whether you are studying activated adipose cells or investigating the role of chemokines in disease progression, the CBL antibody is an indispensable tool in your research arsenal. Order yours today and unlock new insights in your scientific endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V0E2 antibody, catalog no. 70R-2843</p>

<p>STEAP1 antibody was raised in mouse using recombinant human STEAP1 (1-70aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal PLCB2 antibody</p>

<p>Purified native Human PAP protein</p>

<p>Alpha 2 macroglobulin antibody was raised in mouse using human serum alpha-2 macroglobulin as the immunogen.</p>

<p>Rabbit polyclonal RBP4 antibody (FITC)</p>

<p>Rabbit polyclonal TRKB antibody (Tyr705)</p>

<p>CDCA5 antibody was raised using the middle region of CDCA5 corresponding to a region with amino acids ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST</p>

<p>Purified recombinant Human OBFC1 protein (His tag)</p>

<p>SLC9A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI</p>

<p>Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.</p>

<p>CKMM antibody was raised in mouse using purified human CKMM as the immunogen.</p>

<p>Trichomonas vaginalis antibody was raised in mouse using Trichomonas Vaginalis as the immunogen.</p>

<p>Purified native Porcine Haptoglobin protein</p>

<p>Rabbit polyclonal HSD11B1 antibody</p>

<p>Rabbit polyclonal RAP2B antibody</p>

<p>CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE</p>

<p>Purified Polyclonal Kanadaptin antibody</p>

<p>ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG</p>

<p>Rabbit polyclonal TLE1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gm13178 antibody, catalog no. 70R-8604</p>

<p>Purified Rabbit polyclonal BCLXL antibody (Ser62)</p>

<p>Purified recombinant MOB1B protein (His tag)</p>

<p>The Ly6G antibody is a trifunctional monoclonal antibody that is widely used in the field of Life Sciences. It is commonly used for research purposes, specifically in the detection and analysis of various proteins and molecules. This antibody has phosphatase activity, making it a valuable tool for studying signal transduction pathways.</p>

<p>The CD86 antibody is a monoclonal antibody that is widely used in life sciences research. This antibody specifically targets the CD86 antigen, which is expressed on the surface of various immune cells. The CD86 antibody can be used for a variety of applications, including immunohistochemistry, flow cytometry, and Western blotting. It has been shown to have neutralizing activity against the CD86 antigen and can inhibit its interaction with other molecules involved in immune response regulation. Additionally, this antibody has been found to have potential therapeutic applications, particularly in the treatment of inflammatory diseases and cancer. With its high specificity and versatility, the CD86 antibody is an essential tool for researchers in the field of immunology and beyond.</p>

<p>Rabbit polyclonal GPR143 antibody</p>

<p>OLIG3 antibody was raised in rabbit using the N terminal of OLIG3 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy through patch-clamp technique analysis on human erythrocytes.</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>Rabbit polyclonal APIP antibody</p>