Compuestos y reactivos bioquímicos

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RFESD antibody, catalog no. 70R-4404</p>

<p>CD19 antibody (PE-CY5.5) was raised in mouse using human CD19 as the immunogen.</p>

<p>Goat anti Mouse Lambda Light Chain secondary antibody (HRP)</p>

<p>C12ORF4 antibody was raised using the N terminal Of C12Orf4 corresponding to a region with amino acids EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Tropomyosin 3 antibody was raised using the middle region of TPM3 corresponding to a region with amino acids TEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKYEEEIKIL</p>

<p>Please enquire for more information about 4-N-Pentyl-d11-phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CLASP1 antibody was raised in Rat using alpha-CLASP1-N-terminus and GST fusion protein as the immunogen.</p>

<p>Mouse anti Human IgG antibody was raised in Mouse using Human IgG was isolated from human sera and purified by chromatography as the immunogen.</p>

<p>Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED</p>

<p>Purified Polyclonal RPL11 antibody</p>

<p>Mouse monoclonal FceRI alpha antibody</p>

<p>OCEL1 antibody was raised in rabbit using the C terminal of OCEL1 as the immunogen</p>

<p>Piragliatin is a potent inducer of glucose-dependent insulinotropic peptide (GIP) receptor. It has been shown to have a hypoglycemic effect in tissue culture and to reduce hepatic steatosis in mice. Piragliatin also potentiates the effect of glp-1r agonists, which are used for the treatment of type 2 diabetes mellitus, by increasing glucose uptake into fat cells and enhancing insulin secretion.</p>

<p>Recombinant Human CRMP1 protein (His tag)</p>

<p>N,N-Bis-desethyl, N-methyl entacapone is a potent inhibitor of cancer cell growth and has been shown to have anticancer properties. It works by inhibiting the activity of certain proteins that are involved in tumor growth and survival. This inhibitor has been shown to be effective against various types of cancer cells, including those found in human urine and Chinese hamster ovary cells. It has also been found to induce apoptosis, or programmed cell death, in cancer cells. N,N-Bis-desethyl, N-methyl entacapone is an analog of elastase inhibitors and has been shown to inhibit the activity of kinases, which are enzymes that play a key role in cellular signaling pathways. This inhibitor may hold promise for the development of new cancer therapies.</p>

<p>GSK598809 is a non-selective, high-affinity, amide-type dopamine D2 receptor antagonist that is currently in phase II clinical trials for the treatment of dystonia. This drug binds to the D2 receptor with high affinity and specificity and has shown efficacy in animal models of Parkinson's disease. GSK598809 has been shown to have low expression in humans, as well as no adverse effects on human red blood cells. It also has a low potential for abuse or dependence due to its lack of activity at other neurotransmitter receptors.</p>

<p>Inhibitor of dopamine-β-hydroxylase</p>

<p>IGF1R antibody was raised in Mouse using a purified recombinant fragment of IGF1R expressed in E. coli as the immunogen.</p>

<p>CYM 50308 is a synthetic herbicide, which is synthesized through chemical processes designed to target specific plant physiological pathways. Its mode of action involves the inhibition of key enzyme pathways that are essential for the biosynthesis of amino acids in plants. This disruption leads to the cessation of protein synthesis, ultimately causing the death of targeted weed species.</p>

<p>Rabbit polyclonal ALDH3B1 antibody</p>

<p>Rotavirus antibody was raised in mouse using p41 capsid protein of monkey, porcine and human isolates as the immunogen.</p>

<p>C7orf16 antibody was raised in rabbit using the middle region of C7orf16 as the immunogen</p>

<p>MAP4343 is a peptide that has been shown to activate the ERK1/2 and JNK pathways. MAP4343 has also been shown to bind to the TGF-β receptor, which is a receptor tyrosine kinase that regulates cell proliferation, differentiation, and apoptosis. The ligand for this receptor is Transforming Growth Factor beta 1 (TGF-β1). MAP4343 can be used as a research tool for studying protein interactions and receptors.<br>MAP4343 is an inhibitor of Ion channels, such as voltage-gated potassium channels. It can inhibit ion channel currents in Xenopus oocytes expressing human potassium channels by binding to the extracellular domain of these channels. This inhibition leads to a decrease in the membrane potential.</p>

<p>Myosin 7 antibody was raised in rabbit using the middle region of Myosin 7 as the immunogen</p>

<p>Normal Syrian Hamster Serum which has been lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2</p>

<p>GIP (1-39) is an inhibitor of the GIP receptor. It is a research tool used in the study of cell biology and peptides, as well as pharmacology, ligands, and ion channels. GIP (1-39) is also an activator of the GIP receptor. This protein has been shown to have high purity with a specific activity at least 5 times that of other sources.</p>

<p>Dxd is a type of Antibody-Drug Conjugate (ADC), which is a sophisticated therapeutic agent arising from bioconjugate chemistry. It incorporates a monoclonal antibody that specifically targets cancer cell antigens, linked to a cytotoxic payload designed to induce cell death. The mechanism of action involves the highly selective binding of the ADC to a cancer-specific antigen, followed by internalization, and subsequent release of the cytotoxic agent within the cell. This targeted approach allows for the preferential destruction of cancer cells while minimizing damage to healthy tissues.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEMG1 antibody, catalog no. 70R-1587</p>

<p>CD44 antibody (FITC) was raised in mouse using chicken CD44 as the immunogen.</p>

<p>TMPyP4 tosylate is a chemical compound that is used in the treatment of bacterial infections. It is an active substance that can be used to prepare stable complexes with amines, which are then activated by intestinal enzymes. TMPyP4 tosylate has been shown to have binding activities towards telomeric DNA and gram-negative bacteria. This drug has been found to inhibit the growth of typhimurium, a gram-negative bacterium, by interacting with its ribosomal RNA and inhibiting protein synthesis.</p>

<p>BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT</p>

<p>Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.</p>

<p>2-Methyl-3-(5-methylsulfanyl-[1,3,4]oxadiazol-2-yl)-6-trifluoromethyl-pyridine (SCH58261) is a ligand of G protein coupled receptors. It binds to the receptor and activates it by increasing the permeability of ion channels. SCH58261 has been shown to interact with various ion channels such as nicotinic acetylcholine receptor, dopamine receptor, and serotonin receptor. SCH58261 is a potent inhibitor of the activation of β1 adrenergic receptor. It also inhibits the binding of agonists to α1A adrenergic receptor and α2C adrenergic receptor.</p>

<p>B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR</p>

<p>CYP2F1 antibody was raised in Rabbit using Human CYP2F1 as the immunogen</p>

<p>N-[[4-(1-Methylpyrazol-4-yl)phenyl]methyl]-6-[7-(3-pyrrolidin-1-ylpropoxy)imidazo[1,2-a]pyridin-3-yl]pyrimidin-4-amine is a research tool that activates the Ligand and Receptor. It has been developed as a ligand for GPCR receptors, such as the cannabinoid receptor 1 (CB1). This drug also functions as an inhibitor of ion channels, including sodium channels and potassium channels. NMPPIPA also inhibits protein synthesis by binding to ribosomes.</p>

<p>GALNT7 antibody was raised in Rabbit using Human GALNT7 as the immunogen</p>

<p>NDUFS7 antibody was raised in Rabbit using Human NDUFS7 as the immunogen</p>

<p>AK2 antibody was raised using the middle region of AK2 corresponding to a region with amino acids LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT</p>

<p>Rabbit polyclonal MAD4 antibody</p>

<p>The FOXO4 antibody is a monoclonal antibody that specifically targets the protease FOXO4. This protease plays a crucial role in extracellular processes and has been implicated in various diseases. The FOXO4 antibody binds to the protease, inhibiting its activity and preventing it from carrying out its normal functions.</p>

<p>Rat monoclonal CD117 antibody (FITC)</p>

<p>Inflachromene is a molecule that is structurally related to the triterpenoid saponins. It has been found to have immunomodulatory effects on microglia, and it has been suggested that this may be due to its ability to induce autophagy. Inflachromene has also been found to stabilize chemical bonds by forming disulfide bonds, which can be used in sample preparation for analysis. The stability of inflachromene was observed in cell cultures as well as in human liver samples. The molecule has also been shown to have an effect on toll-like receptors (TLRs) and may be an effective treatment for autoimmune diseases such as multiple sclerosis.</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>The p70S6 Kinase antibody is a powerful tool used in scientific research to study various cellular processes. This antibody specifically targets and binds to p70S6 Kinase, a protein involved in cell growth and proliferation. By binding to this protein, the antibody allows researchers to visualize and analyze its activity within cells.</p>

<p>Panobinostat is a drug that belongs to the class of HDAC inhibitors. It is used for the treatment of cancer, autoimmune diseases, and HIV infection. Panobinostat inhibits the histone deacetylase enzyme and reverses the process of cellular differentiation in chronic myeloid leukemia cells. The compound also inhibits tumor growth by inducing apoptosis in cancer cells and by arresting cell cycle progression. Panobinostat has been shown to increase plasma concentrations of pomalidomide in humans, which may be due to its ability to inhibit hepatic metabolism.</p>

<p>CD38 antibody (Allophycocyanin) was raised in rat using CD38 as the immunogen.</p>

<p>Rabbit polyclonal AROS antibody (biotin)</p>

<p>PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>MK204 is a potent antibiotic that inhibits bacterial growth by binding to enzymes. It has been shown to inhibit the activity of nitrogenases, which are enzymes involved in the metabolism of nitrogen. MK204 can also bind to other enzymes, such as acetylcholinesterase and butyrylcholinesterase, which are important for nervous system function. MK204 has been shown to be effective against antibiotic-resistant strains of bacteria, including methicillin-resistant Staphylococcus aureus (MRSA). This drug also has potential as a biomarker for cardiac muscle disorders and metabolic disorders. MK204 is an antioxidant that may protect cells from oxidative stress by scavenging reactive oxygen species.</p>

<p>CD105 antibody (PE) was raised in mouse using membrane preparation of human B-lineage leukemia cells as the immunogen.</p>

<p>MAGED2 antibody was raised in Rabbit using Human MAGED2 as the immunogen</p>

<p>1225-1456 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSVAHL HAPTGSGKST KVPAAYAAQG YKVLVLNPSV AATLGFGAYM SKAHGVDPNI RTGVRTITTG SPITYSTYGK FLADGGCSGG AYDIIICDEC HSTDATSILG IGTVLDQAET AGARLVVLAT ATPPGSVTVS HPNIEEVALS TTGEIPFYGK AIPLEVIKGG RHLIFCHSKK KCDELAAKLV ALGINAVAYY RGLDVSVIPT SGDVVVVSTD ALMTGFTGDF DSVIDCNT</p>

<p>Casein Kinase II Inhibitor VI, TMCB is a drug that inhibits Casein Kinase II (CKII), which is an enzyme that regulates the production of proteins. It has been shown to inhibit the replication of RNA and synthesis of protein in human cells. This drug binds to the active site of CKII, preventing it from phosphorylating other proteins. TMCB has been shown to have an inhibitory effect on cancer cell growth and may be used as an alternative treatment for bone-related diseases such as osteoporosis. TMCB also inhibits herpes simplex virus, a virus responsible for causing cold sores. The inhibition of viral replication by TMCB may be due to its ability to bind acrylonitrile, a nucleophile that inhibits viral DNA polymerase activity. Autologous stem cells are able to form new bone when injected into areas where bone loss has occurred due to tumor necrosis or trauma. The use of this drug</p>

<p>The TYRO3 antibody is a monoclonal antibody that has neutralizing properties against interferon (IFN). It is used as an inhibitor to block the activity of IFN and its downstream effects. This antibody specifically targets the TYRO3 receptor, which is involved in the signaling pathway of IFN. By blocking this receptor, the TYRO3 antibody prevents the activation of downstream pathways that are mediated by IFN.</p>

<p>Jte 607 is a prodrug that is hydrolyzed in vivo to form the active drug, Jte 607 acid. This drug has shown cardioprotective effects in animal models by reducing the expression of proinflammatory cytokines and increasing the production of anti-inflammatory cytokines. It also inhibits tumor necrosis factor (TNF) and interleukin-1β (IL-1β), which are proinflammatory cytokines. The molecular mechanism of Jte 607 is not yet fully understood, but it may be due to its ability to induce apoptosis and inhibit DNA synthesis in tumor cells.</p>

<p>RKI-1447 is a potent inhibitor of ROCK1 and ROCK2, with IC50 of 14.5 nM and 6.2</p>

<p>CD94 antibody was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.</p>

<p>CHI3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL</p>

<p>Purified recombinant E.coli mdh Protein (His tag)</p>

<p>Folcysteine is an enzyme inhibitor that inhibits the synthesis of protein and DNA. It has been shown to have a high affinity for folate receptors, which are involved in the growth of cells. Folcysteine is used as a diagnostic tool for diseases such as rheumatoid arthritis, osteoarthritis, and psoriasis. It can be used in vivo or in vitro to detect the presence of specific antibodies in blood serum or tissue extracts. This drug has also been shown to inhibit transcription-polymerase chain reactions (PCR) and polymerase chain reactions (PCR). The use of folcysteine as a therapeutic agent is limited due to its toxicity, but it may be useful for research purposes.</p>

<p>The STAT5A antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to STAT5A, a protein involved in various cellular processes. This monoclonal antibody has been extensively tested and proven to have high specificity and sensitivity.</p>

<p>Rabbit polyclonal PDGFR beta antibody (Tyr1021)</p>

<p>Tetrakis(2-chloroethyl)phosphorodiamidic chloride is an anticancer agent that targets kinases in human tumor cells. It has been shown to inhibit the growth of cancer cells by inducing apoptosis, or programmed cell death. This compound is a potent inhibitor of protein kinases and has been used as an analog for studying the activity of kinase inhibitors. Tetrakis(2-chloroethyl)phosphorodiamidic chloride has also been found in urine samples from patients undergoing chemotherapy with dapoxetine, suggesting its potential use as a biomarker for cancer treatment. Overall, this compound shows promise as a valuable tool in cancer research and therapy.</p>

<p>CD152 antibody (FITC) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is particularly effective in treating tuberculosis infections due to its bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high potency has been demonstrated through the patch-clamp technique on human erythrocytes. In addition, it undergoes various metabolic transformations such as hydrolysis, oxidation, reduction, and conjugation. Rifapentine specifically targets markers expressed in Mycobacterium tuberculosis strains and hinders their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALT6 antibody, catalog no. 70R-7452</p>

<p>Murf1-in-1 is a peptide that is an activator of the TRPV1 receptor. It has been shown to inhibit the activity of protein kinase C and phospholipase C, and can be used as a research tool for studying the effects of TRPV1 activation on cell biology. Murf1-in-1 also binds to antibodies such as anti-murine TRPV1, which can be used in immunohistochemistry to detect murine TRPV1 expression.<br>TRPV1 is a ligand-gated ion channel that is activated by various substances, including capsaicin, protons and heat. Activation of the TRPV1 receptor leads to changes in membrane potential, cellular excitability and pain sensation.</p>

<p>Rabbit polyclonal PITX2 antibody</p>

<p>Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.</p>

<p>KIF2C antibody was raised using the N terminal of KIF2C corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT</p>

<p>(Z)-6-[(2R,3S)-3-[[(4-Chloro-2-methylphenyl)sulfonylamino]methyl]-2-bicyclo[2.2.2]octanyl]hex-5-enoic acid is a research tool that activates Ligand, Receptor and Cell Biology. It is an ion channel activator that can be used in pharmacology and life science. This inhibitor binds to the receptor site of a ligand and blocks the binding of the ligand to its receptor. The molecular weight of this compound is 687.7 g/mol with purity level of 99%.</p>

<p>SH5-07 is an active analog of the drug survivin. It binds to DNA, inhibiting the synthesis of proteins that are vital for cell division and growth. SH5-07 has been shown to have a strong inhibitory effect on tumor xenografts in mice and human prostate cancer cells.<br>SH5-07 has also been shown to bind specifically to the DNA binding domains of survivin and inhibit its activity, which may be due to its similarity to the molecule's binding site.</p>

<p>2-Docosahexaenoyl-sn-glycero-3-phosphocholine is a component of cell membranes that may be important for cell signaling, regulation of ion transport, and the modulation of membrane fluidity. It has been shown to enhance the rate at which chloride ions diffuse through hydrated erythrocyte membranes. 2-Docosahexaenoyl-sn-glycero-3-phosphocholine binds to bilayers and lipids in a lamellar fashion, which may be due to its polyunsaturated fatty acid composition. The methyl group on this molecule is transferred from an S atom to a C atom in the lipid bilayer, creating an ether linkage. This process is catalyzed by esterases and glucuronidases, which hydrolyze esters or glucuronides attached at carbon 3 in 2DGPC.</p>

<p>Amodiaquine Hydrochloride (USP grade powder) chemical reference substance</p>

<p>CD31 antibody (PE) was raised in rat using murine leukocyte cell line 32D as the immunogen.</p>

<p>Rabbit polyclonal APC1 antibody (Ser688)</p>

<p>Dnaja1 antibody was raised in rabbit using the N terminal of Dnaja1 as the immunogen</p>

<p>BPAM-344 is a new class of agent that has been developed for the treatment of Alzheimer's disease. It has shown low toxicity and good pharmacokinetics in animal studies. BPAM-344 is an ionotropic glutamate receptor antagonist that prevents glutamate from binding to the receptor and activating it. This agent also has the ability to block or prevent the development of tolerance to low doses of x-ray radiation, which may be due to its ability to inhibit structural changes in DNA caused by radiation exposure. The structural analysis of this drug revealed a novel molecular scaffold that is different from other agents in its class. A fluorescence assay confirmed that BPAM-344 binds tightly with aluminum oxide, which may be used as a potential adjuvant for this drug.</p>

<p>KIF25 antibody was raised in rabbit using the N terminal of KIF25 as the immunogen</p>

<p>MYL3 antibody was raised in Rabbit using Human MYL3 as the immunogen</p>

<p>GABRD antibody was raised in rabbit using the N terminal of GABRD as the immunogen</p>

<p>CD62L antibody (biotin) was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.</p>

<p>Perlapine is a drug that binds to the central benzodiazepine receptor and inhibits the binding of ligands to this receptor. Perlapine is used in the treatment of neurological disorders, such as Parkinson's disease and chronic lymphocytic leukemia. It has also been shown to have strong inhibitory effects on serum prolactin levels in rats. The exact mechanism of action for perlapine is unknown, but it has been shown to bind to nitrogen atoms and may be an acetylcholine antagonist or nicotinic acetylcholine receptor antagonist.</p>

<p>QZ59S-SSS is an innovative biochemical reagent, which is derived from a synthetic molecular framework designed for specificity in biochemical interactions. This product operates through selective molecular binding, enabling targeted engagement with specific cellular or molecular entities. It employs precision in its mode of action, ensuring minimal non-specific interactions, which is critical for experimental accuracy in various research settings.</p>

<p>Dorzagliatin is a new drug for the treatment of type 2 diabetes. It has been shown to be effective in diabetic patients, with a long-term efficacy and pharmacokinetic properties. Dorzagliatin has also been shown to have a pharmacological effect on β-cells, which are cells that produce insulin in the pancreas. This drug's activity is due to its ability to inhibit the production of growth factors and plasma concentration–time curve. In addition, dorzagliatin does not have any enantiomeric isomers and can be detected in blood plasma within one hour after administration.</p>

<p>GEA 3162 is an analog of a kinase inhibitor that has shown promising results in the treatment of cancer. It has been shown to induce apoptosis in human cancer cells by inhibiting kinases involved in cell survival and proliferation. GEA 3162 has also been found to inhibit luciferase activity, which is often used as a marker for tumor growth. In Chinese hamster ovary cells, GEA 3162 has been shown to inhibit protein synthesis and the growth of cancer cells. This compound is excreted primarily through urine and shows potential as an anticancer drug with minimal toxicity. Further research is needed to determine its effectiveness against different types of tumors.</p>

<p>Rabbit Polyclonal OR5F1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VARS antibody, catalog no. 70R-3182</p>

<p>Purified Polyclonal EMR4 antibody</p>

<p>BPD 9066 is a small-molecule inhibitor of the DNA methyltransferase enzyme, which is involved in gene expression profiles. BPD 9066 has been shown to have anti-cancer effects in mice with alveolar cell carcinoma. This drug also has an effect on muscle cells by preventing them from converting carbon sources into energy, which may be due to its ability to inhibit the activity of xylan synthase. BPD 9066 also inhibits the growth and proliferation of human papillomavirus (HPV), but does not affect the virus's infectivity.</p>

<p>CD49b antibody (PE) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.</p>

<p>GSK3 alpha antibody was raised in Mouse using a purified recombinant fragment of GSK3 alpha expressed in E. coli as the immunogen.</p>

<p>PI3K and mTOR enzyme inhibitor; anti-cancer agent</p>

<p>Calpastatin antibody was raised in mouse using bovine skeletal muscle calpastatin as the immunogen.</p>

<p>NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD</p>

<p>Rabbit polyclonal AGFG2 antibody</p>

<p>Please enquire for more information about Sstr5 antagonist 1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>