Compuestos y reactivos bioquímicos

<p>INTS4 antibody was raised in Rabbit using Human INTS4 as the immunogen</p>

<p>RP11-78J21.1 antibody was raised using the N terminal of RP11-78J21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN</p>

<p>Rabbit polyclonal TPH2 antibody (Ser58)</p>

<p>Rabbit polyclonal VEGFC antibody (FITC)</p>

<p>LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS</p>

<p>Mouse monoclonal RIT2 antibody</p>

<p>The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.</p>

<p>The SYN1 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SYN1 antigen. This antibody has been extensively tested and proven to be effective in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA).</p>

<p>Mouse monoclonal Complement H antibody (Biotin)</p>

<p>Purified Polyclonal USP35 antibody</p>

<p>Apramycin Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal BCLW antibody</p>

<p>Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA</p>

<p>Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF</p>

<p>Mouse monoclonal p53 antibody (Prediluted for IHC)</p>

<p>Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>Rabbit polyclonal STRADB antibody</p>

<p>TECK antibody was raised in mouse using highly pure recombinant human TECK as the immunogen.</p>

<p>The BECN1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor-like domain of BECN1. It has been shown to neutralize the activity of TNF-α, a pro-inflammatory cytokine involved in various diseases. This specific antibody can inhibit the binding of TNF-α to its receptor and prevent downstream signaling pathways associated with inflammation. In addition, the BECN1 antibody has been found to block the interaction between growth factors and fibronectin, inhibiting cell migration and proliferation. It also shows potential in modulating chemokine expression and regulating TGF-beta signaling. With its wide range of applications in life sciences, this antibody holds promise for research and therapeutic purposes in collagen-related diseases and other inflammatory conditions.</p>

<p>CXCR4 antibody was raised in goat using YSEEVGSGDYDSNKEPCFRDENVHFNR corresponding to the N-terminal extracellular domain of mouse CXCR4 receptor.   as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.</p>

<p>Mouse monoclonal TFAP2C antibody</p>

<p>MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>Sheep polyclonal Ketoprofen antibody</p>

<p>Mouse monoclonal RPN10 antibody</p>

<p>GPD1 antibody was raised in Rabbit using Human GPD1 as the immunogen</p>

<p>Sheep polyclonal 17b Nortestosterone antibody</p>

<p>4-[(6-Chloro-2-methoxy-9-acridinyl)amino]-2-[(4-methyl-1-piperazinyl)methyl]phenol trihydrochloride is an inhibitor of receptor, ligand, and activator. It is a high purity product that is used in life science, pharmacology, and cell biology research. It is also used as a research tool for studying ion channels and peptides. This compound can be used to study protein interactions with antibodies and other proteins.</p>

<p>Purified Polyclonal GYS1 antibody</p>

<p>Rabbit Polyclonal TMEM200A antibody</p>

<p>Purified Rabbit polyclonal OR13G1 antibody</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR</p>

<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>Rabbit polyclonal OR6S1 antibody</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>Rabbit polyclonal ABL1 antibody (Tyr204)</p>

<p>Rabbit polyclonal COX41 antibody</p>

<p>1-646 amino acids: MGSSHHHHHH SSGLVPRGSH MSKGPAVGID LGTTYSCVGV FQHGKVEIIA NDQGNRTTPS YVAFTDTERL IGDAAKNQVA MNPTNTVFDA KRLIGRRFDD AVVQSDMKHW PFMVVNDAGR PKVQVEYKGE TKSFYPEEVS SMVLTKMKEI AEAYLGKTVT NAVVTVPAYF NDSQRQATKD AGTIAGLNVL RIINEPTAAA IAYGLDKKVG AERNVLIFDL GGGTFDVSIL TIEDGIFEVK STAGDTHLGG EDFDNRMVNH FIAEFKRKHK KDISENKRAV RRLRTACERA KRTLSSSTQA SIEIDSLYEG IDFYTSITRA RFEELNADLF RGTLDPVEKA LRDAKLDKSQ IHDIVLVGGS TRIPKIQKLL QDFFNGKELN KSINPDEAVA YGAAVQAAIL SGDKSENVQD LLLLDVTPLS LGIETAGGVM TVLIKRNTTI PTKQTQTFTT YSDNQPGVLI QVYEGERAMT KDNNLLGKFE LTGIPPAPRG VPQIEVTFDI DANGILNVSA VDKSTGKENK ITITNDKGRL SKEDIERMVQ EAEKYKAEDE KQRDKVSSKN SLESYAFNMK ATVEDEKLQG KINDEDKQKI LDKCNEIINW LDKNQTAEKE EFEHQQKELE KVCNPIITKL YQSAGGMPGG MPGGFPGGGA PPSGGASSGP TIEEVD</p>

<p>Adiponectin antibody was raised in mouse using recombinant human adiponectin (15-244aa) purified from E. coli as the immunogen.</p>

<p>Ccna2 antibody was raised in rabbit using the C terminal of Ccna2 as the immunogen</p>

<p>MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids  RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM</p>

<p>ANXA3 antibody is a monoclonal antibody that targets mesothelin, a growth factor that is overexpressed in various types of cancer. This antibody specifically binds to mesothelin and neutralizes its activity, inhibiting tumor growth and metastasis. ANXA3 antibody has been shown to have high specificity and affinity for mesothelin, making it an effective tool for diagnostic assays and potential therapeutic applications. Additionally, this antibody can be used in research studies to investigate the role of mesothelin in cancer development and progression. Overall, ANXA3 antibody offers promise as a valuable tool in the fight against cancer.</p>

<p>Mouse monoclonal Cytokeratin 13 antibody</p>

<p>IQWD1 antibody was raised in Rabbit using Human IQWD1 as the immunogen</p>

<p>BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD</p>

<p>EIF4G3 antibody was raised using the middle region of EIF4G3 corresponding to a region with amino acids MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES</p>

<p>Rabbit polyclonal PSMC6 antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>The Giardia lamblia antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to Giardia lamblia, a common parasite that causes gastrointestinal infections in humans. This antibody works by recognizing and binding to specific proteins on the surface of Giardia lamblia, effectively neutralizing its activity and preventing further infection.</p>

<p>Purified recombinant TRAPPC2 protein</p>

<p>Rabbit polyclonal TSR2 antibody</p>

<p>FBXL4 antibody was raised in mouse using recombinant Human F-Box And Leucine-Rich Repeat Protein 4 (Fbxl4)</p>

<p>Rabbit polyclonal SMAP1 antibody</p>

<p>Rabbit polyclonal RPS27L antibody</p>

<p>N-[2-(3,4-Dichloroanilino)quinolin-4-yl]cyclohexanecarboxamide is a peptide that acts as an activator of ion channels and a ligand for receptors. It also has the ability to inhibit protein interactions. N-[2-(3,4-Dichloroanilino)quinolin-4-yl]cyclohexanecarboxamide is a research tool for cell biology and pharmacology studies. This peptide is used in the study of ion channels and their role in cell signaling. It can be used to study receptor binding or protein interactions with ligands.</p>

<p>GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF</p>

<p>Phosphothreonine-Pro antibody was raised in rabbit using KLH-phosphothreonine-proline amine (pT-P-NH2) peptide conjugate as the immunogen.</p>

<p>The Annexin 1 antibody is a highly specialized monoclonal antibody that targets Annexin 1, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of Annexin 1. It has been shown to have significant applications in the fields of histidine, hepatocyte growth factor, autoantibodies, fatty acid metabolism, and steroid synthesis. Additionally, this antibody has been proven effective in detecting Annexin 1 in various tissues and cell types. Its high specificity and sensitivity make it an invaluable tool for researchers studying natriuretic factors, glycosylation patterns, and other related areas of research. With its exceptional performance and reliability, the Annexin 1 antibody is a must-have for any laboratory conducting cutting-edge research in the field of Life Sciences.</p>

<p>AChE antibody was raised using a synthetic peptide corresponding to a region with amino acids VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal EIF2B3 antibody</p>

<p>The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.</p>

<p>Mouse monoclonal PNMA3 antibody</p>

<p>Rabbit polyclonal ZBTB7B antibody</p>

<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>

<p>Purified homogeneous preparation of Streptavidin protein conjugated to 40nm colloidal gold in solution</p>

<p>Goat anti-rabbit IgG (H+L) (Fab'2) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal PDIA3 antibody (biotin)</p>

<p>Purified recombinant GNRH1 protein (His tag)</p>

<p>Rabbit polyclonal CLDN8 antibody</p>

<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant CSF2RA protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>Purified recombinant SYT5 protein (His tag)</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Rabbit polyclonal JNK1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>

<p>E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.</p>

<p>Rabbit polyclonal TYMS antibody</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP</p>

<p>The CDKN1B antibody is a monoclonal antibody that specifically targets the cyclin-dependent kinase inhibitor 1B (CDKN1B). CDKN1B is a protein that plays a crucial role in cell cycle regulation and acts as a tumor suppressor. This antibody binds to CDKN1B and inhibits its function, leading to uncontrolled cell growth and proliferation.</p>

<p>HNRNPR antibody was raised in Rabbit using Human HNRNPR as the immunogen</p>

<p>The GFAP antibody is a highly specialized polyclonal antibody that is used in Life Sciences research. It is designed to target and neutralize autoantibodies against glial fibrillary acidic protein (GFAP), which is an important marker for astrocytes in the central nervous system. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>