Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas(99.118 productos)
- Por objetivo biológico(99.156 productos)
- Según efectos farmacológicos(6.788 productos)
- Crioconservantes(21 productos)
- Desinfectantes y compuestos relacionados(28 productos)
- Hormonas(346 productos)
- Biología Vegetal(6.748 productos)
- Metabolitos secundarios(14.233 productos)
Se han encontrado 130579 productos de "Compuestos y reactivos bioquímicos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Human CX3CL1 ELISA Kit
<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>Pureza:Min. 95%Neutrophil Gelatinase Associated Lipocalin/Lipocalin-2, human, recombinant
<p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>Pureza:Min. 95%Human TIMP2 ELISA Kit
<p>ELISA kit for detection of TIMP2 in the research laboratory</p>Pureza:Min. 95%ILK-IN-2
CAS:<p>ILK-IN-2 is a molecule that inhibits autophagy in leukemia cells. It has been shown to be effective in inhibiting the growth of meningioma and lymphocytic leukemia cells. ILK-IN-2 has also shown inhibitory properties against chronic lymphocytic leukemia and primary cells, which may be due to its ability to induce apoptosis by activating proapoptotic molecules such as Bax, Bak, and caspase-3. In addition, ILK-IN-2 has demonstrated anti-inflammatory properties that may lead to its use in autoimmune diseases.</p>Fórmula:C30H30F3N5OPureza:Min. 95%Peso molecular:533.59 g/molRef: 3D-IDC14624
Producto descatalogadoBovine Leptin ELISA kit
<p>ELISA Kit for detection of Leptin in the research laboratory</p>Pureza:Min. 95%Cip1 antibody
<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>Pureza:Min. 95%PDE3B antibody
<p>The PDE3B antibody is a protein-based product that belongs to the category of antibodies. It is specifically designed to target and bind to the PDE3B enzyme, which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively tested and validated for its specificity and efficacy.</p>Thyroxine ELISA Kit
<p>ELISA kit for detection of Thyroxine in the research laboratory</p>Pureza:Min. 95%β-Sinensal
CAS:<p>β-Sinensal is an analog of astaxanthin that has shown potent inhibitory activity against human kinases. This compound has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamsters. β-Sinensal has also been found in human urine, suggesting that it may have a role in regulating cellular replication. In addition, this compound has demonstrated synergistic effects with methotrexate, a commonly used cancer drug. β-Sinensal is a promising inhibitor of kinases and may have potential as a therapeutic agent for the treatment of cancer.</p>Fórmula:C15H22OPureza:Min. 95%Peso molecular:218.33 g/molRef: 3D-KCA06688
Producto descatalogadoHSV2 gC antibody
<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>PEDV Nucleocapsid Protein - Purified
<p>This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.</p>Pureza:Min. 95%Hamster (CHO) Glutathione S-Transferase P - ELISA Kit
<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>Pureza:Min. 95%Human Myeloperoxidase (MPO) ELISA Kit
<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Coronavirus (SARS-CoV-2) Spike S1 RBD - Purified from HEK 293
<p>Recombinant SARS-CoV-2 Spike S1 Receptor Binding Domain (RBD; GenBank QHD43416.1, a.a.318-541) with a 6xHIS tag was expressed in HEK293 cells and purified by nickel affinity chromatography. Under SDS-PAGE reducing conditions, the protein is detected at an estimated molecular weight of ~35 kDa. Optimal working dilutions should be determined experimentally by the investigator.</p>FSH ELISA kit
<p>FSH ELISA kit for the quantitative measurement of FSH in human serum</p>Pureza:Min. 95%Human P-Selectin ELISA Kit
<p>ELISA kit for detection of P-Selectin in the research laboratory</p>Pureza:Min. 95%Toxoplasma gondii IgM ELISA kit
<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>Pureza:Min. 95%Rat/Mouse Corticosterone ELISA kit
<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>Pureza:Min. 95%Dog Red Blood Cells
<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>Pureza:Min. 95%Porcine IL17 ELISA kit
<p>ELISA Kit for detection of IL17 in the research laboratory</p>Pureza:Min. 95%LCP1 antibody
<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>MYBPH antibody
<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>Pureza:Min. 95%Human TARC ELISA kit
<p>ELISA Kit for detection of TARC in the research laboratory</p>Pureza:Min. 95%Mouse Cystatin C ELISA Kit
<p>ELISA kit for detection of Cystatin C in the research laboratory</p>Pureza:Min. 95%Human Laminin ELISA Kit
<p>ELISA kit for detection of Laminin in the research laboratory</p>Pureza:Min. 95%Rat Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>Pureza:Min. 95%Mouse Free Thyroxine ELISA kit
<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>Pureza:Min. 95%Phosphatidyl Serine IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>Pureza:Min. 95%Mouse Free Triiodothyronine ELISA kit
<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>Pureza:Min. 95%Gliadin screen ELISA kit
<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>Pureza:Min. 95%Canine Prostaglandin E2 ELISA kit
<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>Pureza:Min. 95%Human IL1 α ELISA kit
<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>Pureza:Min. 95%SYT11 antibody
<p>SYT11 antibody was raised in rabbit using the N terminal of SYT11 as the immunogen</p>Pureza:Min. 95%Human Hemopexin ELISA Kit
<p>Please enquire for more information about Human Hemopexin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Recombinant Human PD-ECGF
<p>Human sequence expressed in sf Insect Cells; purity >97% by SDS-PAGE and analyzed by silver stain.</p>Rat AGP ELISA Kit
<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dog sIL2-R ELISA Kit
<p>A reliable ELISA Kit for quantifying soluble interleukin-2 receptor (sIL-2R, sIL2R, sTAC, sCD25) in dog serum/plasma samples.</p>Pureza:Min. 95%Chicken IgM ELISA Kit
<p>For the quantitative determination of chicken immunoglobulin M (IgM) in biological samples.;</p>Pureza:Min. 95%Dog NGAL ELISA Kit
<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>Pureza:Min. 95%Human VDPB ELISA Kit
<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dysprosium(III) bromide
CAS:<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>Fórmula:Br3DyPureza:Min. 95%Peso molecular:402.21 g/molRef: 3D-FD171801
Producto descatalogadoHuman C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Pureza:Min. 95%Dog CRP ELISA Kit
<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>Pureza:Min. 95%Mouse C3 ELISA Kit
<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>Pureza:Min. 95%Mouse NGAL ELISA Kit
<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Monkey Plasminogen ELISA Kit
<p>Plasminogen is a protein that plays a crucial role in the blood clotting process. It is produced by the liver and circulates in the blood. Plasminogen is inactive in its native form, but it can be converted into its active form, called plasmin, through a process known as fibrinolysis.<br>Fibrinolysis is the body's natural mechanism to dissolve blood clots. When a blood clot forms, plasminogen binds to it. Activators, such as tissue plasminogen activator (tPA), trigger the conversion of plasminogen into plasmin. Plasmin then breaks down the fibrin mesh of the blood clot, leading to its dissolution.<br>This process is important for maintaining proper blood flow and preventing excessive clot formation. Plasminogen and the fibrinolysis pathway are essential components of the body's hemostatic (blood clotting) and thrombolytic (clot dissolution) systems.</p>Pureza:Min. 95%Recombinant Human VEGF-C
<p>Human sequence expressed in CHO Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.</p>Chicken Ovotransferrin (Conalbumin) ELISA Kit
<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>Pureza:Min. 95%Human IgG ELISA Kit
<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>Pureza:Min. 95%CHO NUCB2 ELISA Kit
<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Bovine IgG ELISA Kit
<p>This Bovine IgG ELISA kit is intended for the quantitative determination of total bovine IgG. There is no reactivity to human, mouse, rabbit and rat immunoglobulins.</p>Pureza:Min. 95%Mouse Hemoglobin ELISA Kit
<p>Please enquire for more information about Mouse Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Hamster CHO Legumain ELISA Kit
<p>Hamster (CHO) Legumain ELISA Kit<br>Â <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>Pureza:Min. 95%CHO LPLA2 ELISA Kit
<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Human TRAIL ELISA kit
<p>ELISA kit for the detection of TRAIL in the research laboratory</p>Pureza:Min. 95%SYNCRIP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>Pureza:Min. 95%PF 04217903 mesylate
CAS:<p>PF 04217903 mesylate is a factor receptor inhibitor that inhibits the transcription of insulin-like growth factor and epidermal growth factor. It is used in the treatment of neoplastic disease, such as breast cancer, ovarian cancer, and prostate cancer. PF 04217903 mesylate also inhibits angiogenesis by inhibiting the expression of transcription factors that are involved in this process. These effects may be due to its ability to inhibit the production of erythropoietin and other proangiogenic molecules. PF 04217903 mesylate has been shown to inhibit the proliferation of vascular endothelial cells in vitro and in vivo.</p>Fórmula:C19H16N8O·CH3SO3HPureza:Min. 95%Peso molecular:468.49 g/molRef: 3D-GNB90693
Producto descatalogadoRat B2M ELISA Kit
<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>Pureza:Min. 95%CHO CTSA ELISA Kit
<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Prolactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H244N54O41SPeso molecular:3,576.01 g/mol[Ala81]-MBP (74-85)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H94N20O21Peso molecular:1,371.48 g/molH-His-Arg-OH
CAS:<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Producto descatalogadoMesotocin trifluroacetate
CAS:<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>Fórmula:C43H66N12O12S2Pureza:Min. 95%Peso molecular:1,007.19 g/molRef: 3D-FI108690
Producto descatalogadoHead activator
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H84N12O14Peso molecular:1,125.36 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H58N10O9Peso molecular:762.91 g/molAmyloid beta-Protein (36-38)
CAS:<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>Fórmula:C9H17N3O4Pureza:Min. 95%Peso molecular:231.25 g/molRef: 3D-FA109475
Producto descatalogado05:0 PC
CAS:<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>Fórmula:C18H36NO8PPureza:Min. 95%Peso molecular:425.45 g/molRef: 3D-RCA41434
Producto descatalogadoCJC-1295
CAS:<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>Pureza:Min. 95%Ref: 3D-FC138107
Producto descatalogadoMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>Fórmula:C118H177N35O29S•C2HO2F3Pureza:Min. 95%Forma y color:PowderPeso molecular:2,695.98 g/molRef: 3D-FM109206
Producto descatalogado
