Compuestos y reactivos bioquímicos

<p>EphA2 antibody was raised in mouse using recombinant human EphA2 (559-976aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal CXCL5 antibody (HRP)</p>

<p>Mouse monoclonal PARP16 antibody</p>

<p>The STEAP2 antibody is a polyclonal antibody used in the field of life sciences. It is specifically designed to target and bind to the low-density lipoprotein receptor-related protein 1 (LRP1), which plays a crucial role in regulating cell growth and survival. The STEAP2 antibody has been extensively studied and shown to inhibit the binding of growth factors to LRP1, thereby blocking their signaling pathways.</p>

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP), a protein that is produced during fetal development and in certain cancers. This antibody has been shown to inhibit the growth of endothelial cells, which play a crucial role in tumor angiogenesis. Additionally, the AFP antibody has been used in research studies to investigate the potential therapeutic effects of targeting keratinocyte growth factor (KGF) signaling pathways. It has also demonstrated neutralizing activity against other growth factors, such as VEGF and circumsporozoite protein. The AFP antibody may have potential applications in the field of life sciences and could be a valuable tool for researchers studying cancer biology and developing targeted therapies.</p>

<p>Mouse monoclonal CAPZA1 antibody</p>

<p>PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG</p>

<p>Rabbit polyclonal SYNJ2BP antibody</p>

<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>

<p>HCCA2 antibody was raised in mouse using recombinant Human Hcca2 Protein</p>

<p>Purified recombinant Human GPT2 protein (His tag)</p>

<p>IL1b antibody (biotin) was raised in goat using E. Coli derived recombinant human IL1 beta/IL1F2 as the immunogen.</p>

<p>The LPAR1 antibody is a monoclonal antibody that targets the Lysophosphatidic Acid Receptor 1 (LPAR1). It plays a crucial role in various cellular processes, including cell growth, migration, and survival. This antibody has been extensively studied in the field of life sciences and has shown promising results.</p>

<p>Rabbit polyclonal PUB11 antibody</p>

<p>Human Thyroglobulin (Tg) is a large glycoprotein produced by the thyroid gland, serving as a precursor for the production of thyroid hormones, thyroxine (T₄) and triiodothyronine (T₃). It is synthesized and stored in the thyroid follicular cells, where it plays a crucial role in hormone synthesis by binding iodine and undergoing enzymatic processing to release active thyroid hormones into the bloodstream.</p>

<p>Human phosphopeptide (Ser876) immunogen; rabbit polyclonal PKD2 antibody (Ser876)</p>

<p>Mouse monoclonal CXorf26 antibody</p>

<p>Mouse monoclonal UNG antibody</p>

<p>Rat IgG antibody was raised in mouse using Rat IgG Fc region as the immunogen.</p>

<p>HK2 antibody was raised in Mouse using a purified recombinant fragment of human HK2 expressed in E. coli as the immunogen.</p>

<p>The IGF2R antibody is a protein-based molecule drug that belongs to the class of monoclonal antibodies. It specifically targets the insulin-like growth factor 2 receptor (IGF2R), which plays a crucial role in regulating cell growth and development. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various immunoassays.</p>

<p>The BCKDK antibody is a cytotoxic monoclonal antibody that acts as an inhibitor of tyrosine binding proteins. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically targets CXCL13, a matrix metalloproteinase that plays a crucial role in cell migration and tissue remodeling.</p>

<p>PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE</p>

<p>Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK</p>

<p>KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds in Mycobacterium tuberculosis strains. This bactericidal drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid, this drug shows remarkable potential in treating tuberculosis infections.</p>

<p>Rabbit polyclonal TXNDC3 antibody</p>

<p>The Caspase 3 antibody is a highly effective growth factor that is commonly used in Life Sciences research. It is known for its ability to detect and neutralize active agents that can cause cell death. This antibody specifically targets caspase 3, a key enzyme involved in apoptosis. By binding to caspase 3, the antibody inhibits its activity and prevents cell death from occurring.</p>

<p>Mouse monoclonal CCM2 antibody</p>

<p>The CDC6 antibody is a cytotoxic hormone peptide that has been shown to have inhibitory effects on antiphospholipid antibodies. It acts as an electrode for interferon and dopamine, and it also functions as a glycoprotein with anticoagulant and antiviral properties. This monoclonal antibody is specifically designed to target human serum autoantibodies, making it highly effective in treating various conditions related to autoimmune disorders. Additionally, the CDC6 antibody has been found to exhibit leukemia inhibitory factor activity, further enhancing its therapeutic potential.</p>

<p>Dicloxicillin Conjugate for use in immunoassays</p>

<p>The FHL1 antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) and leukemia inhibitory factor (LIF). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal RDBP antibody</p>

<p>Rabbit polyclonal JIP1 antibody</p>

<p>Mouse monoclonal HDHD1 antibody</p>

<p>JMJD6 antibody was raised in Rabbit using Human JMJD6 as the immunogen</p>

<p>The ULBP2 antibody is a monoclonal antibody that acts as a growth factor and anti-VEGF (vascular endothelial growth factor). It belongs to the family of natriuretic globulin antibodies, which are binding proteins that regulate blood pressure and fluid balance. This antibody specifically targets ULBP2, a protein that plays a role in immune response regulation. By binding to ULBP2, the antibody can modulate the activity of immune cells and influence various physiological processes. The ULBP2 antibody can also be used in research and diagnostic applications in the field of Life Sciences. With its high specificity and affinity, this polyclonal antibody is an essential tool for studying the functions of ULBP2 and its interaction with other molecules in different biological systems.</p>

<p>1-575 amino acids: MGSSHHHHHH SSGLVPRGSH MSAATHSPMM QVASGNGDRD PLPPGWEIKI DPQTGWPFFV DHNSRTTTWN DPRVPSEGPK ETPSSANGPS REGSRLPPAR EGHPVYPQLR PGYIPIPVLH EGAENRQVHP FHVYPQPGMQ RFRTEAAAAA PQRSQSPLRG MPETTQPDKQ CGQVAAAAAA QPPASHGPER SQSPAASDCS SSSSSASLPS SGRSSLGSHQ LPRGYISIPV IHEQNVTRPA AQPSFHQAQK THYPAQQGEY QTHQPVYHKI QGDDWEPRPL RAASPFRSSV QGASSREGSP ARSSTPLHSP SPIRVHTVVD RPQQPMTHRE TAPVSQPENK PESKPGPVGP ELPPGHIPIQ VIRKEVDSKP VSQKPPPPSE KVEVKVPPAP VPCPPPSPGP SAVPSSPKSV ATEERAAPST APAEATPPKP GEAEAPPKHP GVLKVEAILE KVQGLEQAVD NFEGKKTDKK YLMIEEYLTK ELLALDSVDP EGRADVRQAR RDGVRKVQTI LEKLEQKAID VPGQVQVYEL QPSNLEADQP LQAIMEMGAV AADKGKKNAG NAEDPHTETQ QPEATAAATS NPSSMTDTPG NPAAP</p>

<p>Mouse monoclonal SARS Nucleocapsid antibody</p>

<p>Rabbit polyclonal C1QBP antibody</p>

<p>MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP</p>

<p>Diclazuril chemical reference substance</p>

<p>OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA</p>

<p>The SERPINA3 antibody is a monoclonal antibody that targets the SERPINA3 protein. This protein plays a crucial role in various biological processes, including the regulation of lipoprotein metabolism and mineralocorticoid receptor activity. The antibody specifically binds to the SERPINA3 protein, forming a protein complex that inhibits its function.</p>

<p>PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The FOXB2 antibody is a highly specialized antibody that targets specific proteins and markers in various biological processes. This antibody specifically binds to osteopontin, E-cadherin, amyloid plaque, oncostatin, glutamate, serum albumin protein, and β-catenin. It is widely used in the field of life sciences for research purposes.</p>

<p>The SRY antibody is a biomolecule that specifically targets the sex-determining region Y (SRY) protein. It is commonly used in research involving mesenchymal stem cells and brain natriuretic peptide. This antibody is buffered to ensure stability and effectiveness in various experimental conditions. The SRY antibody is available as both polyclonal antibodies and monoclonal antibodies, providing researchers with different options depending on their specific needs. It can be used as a standalone reagent or as part of a conjugate compound for enhanced detection and analysis. With its cytotoxic and growth factor properties, the SRY antibody plays a crucial role in various life sciences applications.</p>

<p>HCFC2 antibody was raised in mouse using recombinant Human Host Cell Factor C2</p>

<p>Purified recombinant UNG protein (His tag)</p>

<p>SLC27A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW</p>

<p>Abcf1 antibody was raised in rabbit using the C terminal of Abcf1 as the immunogen</p>

<p>ZBTB32 antibody was raised in rabbit using the N terminal of ZBTB32 as the immunogen</p>

<p>Rabbit polyclonal RB antibody (Thr821)</p>

<p>Recombinant Human AKT1 protein (His tag)</p>

<p>HTR7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The RB antibody is a highly specialized monoclonal antibody that has been developed for ultrasensitive detection in the field of Life Sciences. This antibody exhibits high affinity and specificity towards its target molecule, making it ideal for immunoassays and other research applications.</p>

<p>Mouse monoclonal NPTN antibody</p>

<p>ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA</p>

<p>NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT</p>

<p>Mouse monoclonal GSTO2 antibody</p>

<p>The LOX antibody is a reactive monoclonal antibody that is activated through chromatographic techniques. It is specifically designed to target and bind to LOX, a chemokine involved in various cellular processes. This antibody has been extensively used in research studies, such as Western blotting and immunohistochemistry, to detect the presence and localization of LOX in different tissues and cell types. Additionally, the LOX antibody has shown promising results in multidrug resistance studies, particularly in cardiomyocytes where it inhibits the efflux of anticancer drugs. Furthermore, this monoclonal antibody has demonstrated its potential therapeutic applications in regulating glucagon secretion and modulating polyunsaturated fatty acid metabolism. With its high specificity and affinity, the LOX antibody is an invaluable tool for researchers in the life sciences field.</p>

<p>Rabbit polyclonal ARHGDIA antibody</p>

<p>NEIL2 antibody was raised in mouse using recombinant Human Nei Like 2 (E. Coli)</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Sheep polyclonal Tramadol N antibody</p>

<p>Purified Polyclonal CK1 gamma 3 antibody</p>

<p>ZNF415 antibody was raised in rabbit using the N terminal of ZNF415 as the immunogen</p>

<p>DISP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV</p>

<p>The CLPP antibody is a monoclonal antibody that targets collagen, a crucial component in the growth and development of various tissues. This antibody has been extensively studied for its potential therapeutic applications in promoting the growth and differentiation of mesenchymal stem cells. It works by binding to specific receptors on the surface of these cells, triggering a series of signaling events that promote cell proliferation and tissue regeneration.</p>

<p>Purified recombinant GOLGA7 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANGPT4 antibody, catalog no. 70R-5269</p>

<p>ADRA2C antibody was raised in rabbit using a synthetic peptide comprising internal residues of the human Alpha 2c protein as the immunogen.</p>

<p>Purified Polyclonal CRABP2 antibody</p>

<p>Rabbit polyclonal USP32 antibody</p>

<p>Donkey anti-guinea pig IgG (H + L) (Cy3) was raised in donkey using guinea pig IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal TAF9 antibody</p>

<p>Purified recombinant Mouse LGALS3 protein</p>

<p>Purified recombinant IFNL2 protein (His tag)</p>

<p>C1ORF75 antibody was raised using the N terminal Of C1Orf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP</p>

<p>Rabbit polyclonal VAMP5 antibody</p>

<p>The ACSS2 antibody is a powerful tool in the field of life sciences. It specifically targets and detects TGF-beta, alpha-fetoprotein, and phosphatase-activated adenosine triphosphate. This monoclonal antibody is widely used for immunohistochemical detection in various research applications.</p>

<p>LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL</p>

<p>Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(c) fragment as the immunogen.</p>

<p>The Chk2 antibody is a potent inhibitor of the catechol-O-methyltransferase (COMT) family kinase. It has been shown to induce necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated cell death in cancer cells. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of Plasmodium falciparum, the parasite that causes malaria. The Chk2 antibody is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers studying various biological processes. Its cytotoxic properties make it an ideal candidate for targeted therapies against cancer, while its nuclear localization allows for efficient detection and analysis in immunofluorescence experiments.</p>

<p>Purified recombinant GULP1 protein (His tag)</p>

<p>Purified Polyclonal Cytochrome P450 2A7 antibody</p>

<p>Insulin-Like Growth Factor Monoclonal Antibody (HRP)</p>

<p>FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK</p>

<p>HIST2H2AC antibody was raised using the middle region of HIST2H2AC corresponding to a region with amino acids IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>GABRA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW</p>

<p>ZNF385 antibody was raised in rabbit using the N terminal of ZNF385 as the immunogen</p>

<p>FCRL4 antibody was raised using the N terminal of FCRL4 corresponding to a region with amino acids FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR</p>

<p>The STRAP antibody is a highly specialized monoclonal antibody that targets human serum albumin. It contains an EGF-like domain, which allows it to bind specifically to epidermal growth factor (EGF). This antibody is widely used in Life Sciences research for various applications, including immunoassays and molecular docking studies.</p>

<p>Rabbit polyclonal TSC22D1 antibody</p>

<p>MRPL12 antibody was raised in Rabbit using Human MRPL12 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf10 antibody, catalog no. 70R-5858</p>

<p>Rabbit polyclonal PEK antibody</p>

<p>61-184 amino acids: MASMTGGQQM GRGSMSSSED KITVHFINRD GETLTTKGKV GDSLLDVVVE NNLDIDGFGA CEGTLACSTC HLIFEDHIYE KLDAITDEEN DMLDLAYGLT DRSRLGCQIC LTKSMDNMTV RVPETVADAR QSIDVGKTS</p>