Compuestos y reactivos bioquímicos

<p>Mouse monoclonal SYNJ1 antibody</p>

<p>Purified Polyclonal MKL2 antibody</p>

<p>BSA conjugated Sulfadimidine Hapten</p>

<p>RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV</p>

<p>PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL</p>

<p>ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogen</p>

<p>KCNH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG</p>

<p>IRF9 antibody was raised in Rabbit using Human IRF9 as the immunogen</p>

<p>Rabbit polyclonal UTP23 antibody</p>

<p>The CD90 antibody is a monoclonal antibody that targets the sclerostin protein. It is used to neutralize the activity of sclerostin, which is a negative regulator of bone growth. By blocking sclerostin, the CD90 antibody promotes bone formation and can potentially be used in the treatment of conditions such as osteoporosis.</p>

<p>Mouse monoclonal SERPINA5 antibody</p>

<p>PPP2R1B antibody was raised using a synthetic peptide corresponding to a region with amino acids EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ</p>

<p>Rabbit polyclonal TLP4 antibody</p>

<p>GNG2 antibody was raised in Rabbit using Human GNG2 as the immunogen</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>Rabbit polyclonal TCF3 antibody</p>

<p>Mouse monoclonal NTF3 antibody</p>

<p>The 4EBP1 antibody is a polyclonal antibody that belongs to the class of drug antibodies. It is widely used in life sciences research as an inhibitor and neutralizing agent. This antibody specifically targets and binds to 4EBP1, a family of binding proteins involved in regulating protein synthesis. The 4EBP1 antibody can be used in various applications such as Western blotting, immunoprecipitation, and immunofluorescence. It is buffered and optimized for use in different experimental conditions. Whether you are studying interleukins, ranolazine, or other chimeric proteins, the 4EBP1 antibody is a valuable tool for detecting and analyzing activated proteins. With its high specificity and sensitivity, this monoclonal antibody ensures accurate and reliable results in your research experiments.</p>

<p>ZNF365 antibody was raised in rabbit using the N terminal of ZNF365 as the immunogen</p>

<p>Mouse monoclonal ERCC4 antibody</p>

<p>Rabbit polyclonal HMGB1 antibody (FITC)</p>

<p>Rabbit polyclonal VPS26A antibody</p>

<p>Rabbit polyclonal URB1 antibody</p>

<p>Rabbit polyclonal Chk2 antibody (Thr383)</p>

<p>Rabbit polyclonal VEGFC antibody (HRP)</p>

<p>Rabbit polyclonal REX4 antibody</p>

<p>RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP</p>

<p>LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>SNAPC4 antibody was raised in mouse using recombinant Small Nuclear Rna Activating Complex, Polypeptide 4,190Kda (Snapc4)</p>

<p>C9ORF127 antibody was raised using the C terminal Of C9Orf127 corresponding to a region with amino acids CYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS</p>

<p>ALK1 protein is a biomolecule that plays a crucial role in various biological processes. It is a growth factor receptor that belongs to the transforming growth factor-beta (TGF-β) receptor family. ALK1 protein is activated by binding to ligands such as adalimumab and dopamine, which triggers intracellular signaling pathways involved in cell proliferation, differentiation, and migration.</p>

<p>PHF1 antibody was raised in mouse using recombinant Human Phd Finger 1 (Phf1)</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Sheep polyclonal Sulphaphenazole antibody</p>

<p>Rabbit polyclonal LHR2A antibody</p>

<p>ZNF237 antibody was raised in rabbit using the N terminal of ZNF237 as the immunogen</p>

<p>Karyopherin Alpha 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA</p>

<p>2002-G12 is a peptide that can be used as a research tool to study protein interactions and receptor ligand pharmacology. It has been shown to inhibit the activity of ion channels, such as potassium channels. 2002-G12 is an activator of antibody production. It may also be used to study cell biology, including the interactions between proteins in cells and their receptors, which are targets for drug development. This peptide has high purity and can be obtained with CAS No. 313666-93-2.</p>

<p>NORE1 antibody was raised in rabbit using residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein as the immunogen.</p>

<p>PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA</p>

<p>Chicken anti Rabbit IgG secondary antibody (FITC)</p>

<p>DOR1 antibody was raised in rabbit using a synthetic peptide comprising residues 361-372 TPSDGPGGGAAA of the human DOR-1 protein as the immunogen.</p>

<p>Mouse monoclonal KHK antibody</p>

<p>The TIMP1 protein is a versatile molecule with various characteristics and functions. It has been found to have interactions with interleukin-6, a basic protein that plays a crucial role in immune responses. Additionally, it has been shown to be involved in the formation of autoantibodies and possesses acetyltransferase activity.</p>

<p>Rabbit polyclonal CDC42EP3 antibody</p>

<p>The Ubiquitin antibody is a cytotoxic monoclonal antibody that has neutralizing properties against ferritin, chemokines, and interferons. It is a glycoprotein that specifically targets ubiquitin, a protein involved in various cellular processes such as protein degradation and DNA repair. This antibody can be used in Life Sciences research to study the role of ubiquitin in different biological pathways. The Ubiquitin antibody has been tested for its efficacy in inhibiting hemolysis and has shown promising results. It does not contain any excipients or liver microsomes, making it safe for use in laboratory experiments.</p>

<p>Rabbit polyclonal GLB1L3 antibody</p>

<p>HIST1H1T antibody was raised using the middle region of HIST1H1T corresponding to a region with amino acids KLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRAT</p>

<p>UNC93B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AASDH antibody, catalog no. 70R-3281</p>

<p>mCherry Fluorescent Protein is a versatile tool widely used in the field of Life Sciences. It is a growth factor that can be utilized for various applications such as studying protein-protein interactions, monitoring gene expression, and visualizing cellular structures.</p>

<p>Mouse monoclonal NAGK antibody</p>

<p>Purified Polyclonal XPO2 antibody</p>

<p>Purified recombinant MED7 protein (His tag)</p>

<p>Mouse monoclonal CD13 antibody (allophycocyanin)</p>

<p>TNK1 antibody is a reactive antibody that specifically targets the TNK1 protein. TNK1 is involved in various cellular processes, including the epidermal growth factor (EGF) signaling pathway. This antibody can be used in Life Sciences research to study the role of TNK1 in different biological systems. It has been shown to bind to TNK1 with high specificity and affinity. The TNK1 antibody can also be used as a diagnostic tool for detecting TNK1 levels in patient samples. Additionally, this antibody can be used in immunohistochemistry assays to visualize the localization of TNK1 within tissues. With its ability to recognize and bind to TNK1, this antibody offers researchers a valuable tool for understanding the function of this protein in various cellular processes.</p>

<p>Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids  KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG</p>

<p>Mouse monoclonal ACOT7 antibody</p>

<p>Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV</p>

<p>Rabbit polyclonal PRLHR antibody</p>

<p>SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV</p>

<p>Goat anti-human IgM (Fab'2) (FITC) was raised in goat using human IgM Fc5m fragment as the immunogen.</p>

<p>Nestin Monoclonal Antibody (HRP)</p>

<p>Rabbit polyclonal RFTN2 antibody</p>

<p>CAPN11 antibody was raised in Rabbit using Human CAPN11 as the immunogen</p>

<p>The TNKS antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes the activity of tankyrase enzymes. Tankyrases play a crucial role in various cellular processes, including the regulation of Wnt signaling, telomere maintenance, and DNA repair.</p>

<p>The TRPM4 antibody is a high-quality monoclonal antibody that specifically targets the TRPM4 protein. This antibody is widely used in life sciences research and has been shown to have excellent specificity and sensitivity. It binds to the carbonyl group of the TRPM4 protein, inhibiting its activity and preventing downstream signaling pathways.</p>

<p>Rabbit polyclonal Smad3 antibody (Ser204)</p>

<p>The PKNOX1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the PKNOX1 protein, a human protein that plays a crucial role in various cellular processes. This antibody has been extensively characterized and exhibits high specificity and affinity towards PKNOX1.</p>

<p>The UHRF1 antibody is a polyclonal antibody that specifically targets the protein UHRF1. UHRF1 plays a crucial role in epigenetic regulation and is involved in various cellular processes, including DNA methylation, chromatin remodeling, and gene expression. This antibody allows for the detection and analysis of UHRF1 levels in different biological samples.</p>

<p>Mouse monoclonal GOLGA5 antibody</p>

<p>The FGF21 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to FGF21, a growth factor involved in various biological processes. This antibody has been extensively studied and characterized for its ability to inhibit the activity of FGF21.</p>

<p>BSA antibody was raised in rabbit using bovine albumin as the immunogen.</p>

<p>The TFG antibody is a powerful tool in the field of Life Sciences. It is specifically designed to target and detect cardiomyocytes, making it ideal for studying various aspects of cardiac function. This antibody can be used in multidrug studies, electrophoresis experiments, and polymerase chain reactions to analyze the effects of different substances on cardiomyocyte activity.</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>SSB antibody is a monoclonal antibody that specifically targets the SSB protein. This protein plays a crucial role in various biological processes, including DNA replication and repair. The SSB antibody can be used in research and diagnostic applications to study the function of SSB and its interactions with other proteins.</p>

<p>DS44170716 is a mitochondrial-targeted drug that inhibits the mitochondrial permeability transition pore (MPTP) and prevents Ca2+ overload in mitochondria. It is also a membrane-permeable small molecule, which can be taken up by cells and accumulate in mitochondria. DS44170716 may act as an intracellular Ca2+ chelator, preventing reactive cytosolic Ca2+ from entering the mitochondria and thereby inhibiting cellular signaling pathways involved in cell death. DS44170716 has been shown to prevent liver injury induced by ischemia reperfusion in rats.</p>

<p>Recombinant Human LOX protein</p>

<p>Rabbit polyclonal GOLM1 antibody (HRP)</p>

<p>Goat anti Human IgG (H + L) secondary antibody (HRP)</p>

<p>The CDK1 antibody is a monoclonal antibody that specifically targets and inhibits the activity of cyclin-dependent kinase 1 (CDK1). CDK1 is a protein kinase involved in cell cycle regulation, making it an important target for therapeutic interventions. This antibody has been shown to effectively block the activity of CDK1, thereby preventing cell proliferation and promoting cell death.</p>

<p>GNPNAT1 antibody was raised in Rabbit using Human GNPNAT1 as the immunogen</p>

<p>Purified recombinant PCP4L1 protein (His tag)</p>

<p>ACTL7B antibody was raised using the middle region of ACTL7B corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA</p>

<p>Rabbit polyclonal OR6P1 antibody</p>

<p>Rabbit polyclonal DNA Polymerase zeta antibody</p>

<p>Mouse monoclonal WWTR1 antibody</p>

<p>ERC1 antibody was raised in rabbit using the C terminal of ERC1 as the immunogen</p>

<p>The IL1R1 protein is a growth factor that plays a crucial role in various biological processes. It is involved in cell proliferation, differentiation, and immune responses. This protein is highly stable and exhibits excellent photostability, making it ideal for research purposes. IL1R1 protein can be conjugated with other molecules such as cellulose or glycopeptides to enhance its functionality. It can also be used as a molecular target for the development of therapeutic agents. Additionally, monoclonal antibodies targeting IL1R1 have shown promising results in treating certain diseases by blocking its activity. Overall, the IL1R1 protein offers great potential in the field of Life Sciences and holds promise for future advancements in medical research.</p>

<p>Purified Polyclonal Caspase 3 p17 antibody</p>

<p>ATPase binding domain, N-term; 1-384 amino acids: MGKIIGIDLG TTNSCVAIMD GTTPRVLENA EGDRTTPSII AYTQDGETLV GQPAKRQAVT NPQNTLFAIK RLIGRRFQDE EVQRDVSIMP FKIIAADNGD AWVEVKGQKM APPQISAEVL KKMKKTAEDY LGEPVTEAVI TVPAYFNDAQ RQATKDAGRI AGLEVKRIIN EPTAAALAYG LDKGTGNRTI AVYDLGGGTF DISIIEIDEV DGEKTFEVLA TNGDTHLGGE DFDSRLINYL VEEFKKDQGI DLRNDPLAMQ RLKEAAEKAK IELSSAQQTD VNLPYITADA TGPKHMNIKV TRAKLESLVE DLVNRSIEPL KVALQDAGLS VSDIDDVILV GGQTRMPMVQ KKVAEFFGKE PRKDVNPDEA VAIGAAVQGG VLTG</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Its efficacy has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Furthermore, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high binding specificity to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>Collagen type X antibody was raised in rabbit using purified type X collagen from rat chondrosarcoma cells as the immunogen.</p>

<p>IL3 antibody was raised in Rabbit using Human IL3 as the immunogen</p>

<p>Rabbit polyclonal RPL31 antibody</p>

<p>PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF</p>

<p>Rabbit polyclonal IRS1 antibody (Ser794)</p>

<p>BSA conjugated Vitamin B2 Hapten</p>

<p>Rabbit polyclonal MAP3K7 antibody</p>