Compuestos y reactivos bioquímicos

<p>Rabbit polyclonal cJun antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF676 antibody, catalog no. 70R-8867</p>

<p>Rabbit polyclonal HSPA13 antibody (biotin)</p>

<p>Purified recombinant Human CETN3 protein</p>

<p>The Bub1 Antibody is a highly effective monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and neutralize the protein kinase activity of Bub1, a key regulator of the cell cycle. This antibody has been shown to inhibit the phosphorylation of downstream targets, such as p38 MAPK, and interfere with cell growth and proliferation. Additionally, it has been demonstrated to block the activation of phosphatases and reduce the levels of interleukin-6, an important pro-inflammatory cytokine. With its high specificity and potency, the Bub1 Antibody is an essential tool for studying cell signaling pathways and understanding their role in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHF19 antibody, catalog no. 70R-8879</p>

<p>Rabbit Polyclonal Rb antibody (Ser807)</p>

<p>PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM12 antibody, catalog no. 70R-6059</p>

<p>Rabbit polyclonal ACVL1 antibody</p>

<p>The COL3A1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the COL3A1 gene, which encodes for the collagen type III alpha 1 chain protein. This protein is predominantly found in cardiomyocytes and plays a crucial role in maintaining the structural integrity of the heart. The COL3A1 antibody has been extensively tested and validated for its specificity and sensitivity. It has shown excellent performance in various applications, including Western blotting, immunohistochemistry, and ELISA assays. In addition to its high affinity for the target protein, this antibody also exhibits minimal cross-reactivity with other proteins commonly found in human serum or albumin. This ensures accurate and reliable results in experiments involving complex biological samples. Researchers have also reported successful use of the COL3A1 antibody in combination with other antibodies, such as anti-CD20 antibodies or protein kinase inhibitors. This allows for more comprehensive studies on signaling pathways or cellular interactions involving COL3</p>

<p>EXT2 antibody was raised in Rabbit using Human EXT2 as the immunogen</p>

<p>PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX4 antibody, catalog no. 70R-8248</p>

<p>Affinity purified Rabbit polyclonal FBXO43 antibody</p>

<p>The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.</p>

<p>HCG antibody was raised against Human hCG (intact).</p>

<p>FILIP1L antibody was raised using the middle region of FILIP1L corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY</p>

<p>CTNND1 antibody was raised in Rabbit using Human CTNND1 as the immunogen</p>

<p>AMBRA1 antibody was raised in Rabbit using Human AMBRA1 as the immunogen</p>

<p>CRISPR/Cas9 Monoclonal Antibody (HRP)</p>

<p>The ABCA1 antibody is a neuroprotective monoclonal antibody that plays a crucial role in the field of Life Sciences. It is widely used in research and medical applications to study the function and regulation of ABCA1, a key protein involved in lipid metabolism and cholesterol efflux. This antibody specifically targets ABCA1 and inhibits its proteolytic activity, preventing the degradation of this important protein.</p>

<p>The ATOH1 protein is a crucial component in the field of Life Sciences and is widely used in research and development. It is commonly utilized as an antibody, recombinant protein, and antigen for various applications. The ATOH1 protein plays a significant role in the regulation of cell differentiation, particularly in mesenchymal stem cells.</p>

<p>ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE</p>

<p>The SAMHD1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in various research applications. The antibody can be used for particle chemiluminescence assays to detect the presence and activity of SAMHD1 protein. It has been shown to have high specificity and sensitivity, making it an ideal tool for studying this important protein.</p>

<p>The PDGFRB antibody is an active agent that plays a crucial role in various biological processes. It is an autoantibody that can be used as a medicine to target specific cells or molecules in the body. This antibody has been shown to regulate the interferon-stimulated gene and modulate the release of neurotransmitters such as acetylcholine and dopamine. Additionally, it has been found to have pluripotent stem cell properties, making it valuable in regenerative medicine research.</p>

<p>WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STOML3 antibody, catalog no. 70R-7077</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD7 antibody, catalog no. 70R-3764</p>

<p>NGAL antibody is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a protein that plays a crucial role in various biological processes, including the regulation of epidermal growth factor and fatty acid metabolism. This antibody is widely used in Life Sciences research, particularly in the field of Antibodies and colloidal studies. It has been shown to inhibit the activity of growth factors such as anti-CD33 antibody and chemokines, as well as cytokines like interleukin-6. NGAL antibody is also used in the study of mesenchymal stem cells and their differentiation processes. Its high specificity and low viscosity make it an ideal tool for researchers studying NGAL-related pathways and developing inhibitors for therapeutic purposes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DOK5 antibody, catalog no. 70R-3341</p>

<p>Mouse monoclonal Reticulon 1A/B antibody</p>

<p>Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFRP antibody, catalog no. 70R-6476</p>

<p>LYVE1 antibody was raised in rabbit using recombinant mouse soluble Lyve-1 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNPO2 antibody, catalog no. 70R-2016</p>

<p>VEGFB antibody was raised in rabbit using the middle region of VEGFB as the immunogen</p>

<p>DNMBP antibody was raised in Rabbit using Human DNMBP as the immunogen</p>

<p>1-114 amino acids: MTCKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTPLEHHHH HH</p>

<p>The Tau antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is widely used for ultrasensitive detection and analysis of protein carbonyls, particularly in human serum samples. This antibody has been extensively studied and proven to be effective in detecting and neutralizing fibrinogen, a key protein involved in blood clotting.</p>

<p>The C-Fos antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein c-Fos, which is involved in various cellular processes such as cell growth and differentiation. This antibody recognizes the amino group of c-Fos and can be used for applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN2 antibody, catalog no. 70R-5388</p>

<p>Purified Polyclonal Renin Receptor antibody</p>

<p>Rabbit polyclonal LSHR antibody</p>

<p>The HDAC2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to target and bind to histone deacetylase 2 (HDAC2), an enzyme involved in the regulation of gene expression. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal MAP1S antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED4 antibody, catalog no. 70R-1481</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The Glutamate receptor 2 antibody is a highly reactive monoclonal antibody that is used in life sciences research. It specifically targets the glutamate receptors present in various protein isoforms. The antibody works by binding to the receptors and disrupting protein-protein interactions, thus inhibiting the activation of colony-stimulating factors. This leads to a reduction in cytotoxic effects and promotes the pluripotency of cells. The Glutamate receptor 2 antibody is produced using recombinant vaccinia technology, ensuring high purity and specificity. Additionally, it forms a stable disulfide bond with its target, resulting in long-lasting and reliable results. Researchers can rely on this monoclonal antibody for accurate detection and analysis of β-catenin signaling pathways.</p>

<p>HORMAD2 antibody was raised using the middle region of HORMAD2 corresponding to a region with amino acids YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPON2 antibody, catalog no. 70R-6083</p>

<p>Purified native CMV protein (nuclear)</p>

<p>ApoA-V antibody was raised in Mouse using Ni-NTA purified Recombinant human APOA5 expressed in Ecoli strain BL21 (DE3) as the immunogen.</p>

<p>Rabbit polyclonal FA10 antibody</p>

<p>BCL7C antibody was raised in Rabbit using Human BCL7C as the immunogen</p>

<p>The ALDH2 antibody is an activated basic protein that falls under the category of Life Sciences. It is a monoclonal antibody that targets ALDH2, an enzyme involved in the metabolism of alcohol and other aldehydes. This antibody has been widely used in research studies to investigate the role of ALDH2 in various biological processes.</p>

<p>FGFR2 antibody was raised in rabbit using the middle region of FGFR2 as the immunogen</p>

<p>Rabbit polyclonal OR8K1 antibody</p>

<p>Recombinant Human CD4 protein (His tag)</p>

<p>GFOD2 antibody was raised in Rabbit using Human GFOD2 as the immunogen</p>

<p>EXOC1 antibody was raised in rabbit using the N terminal of EXOC1 as the immunogen</p>

<p>DOCK7 antibody was raised in Rabbit using Human DOCK7 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FKTN antibody, catalog no. 70R-1753</p>

<p>The PGAM1 antibody is a highly specific monoclonal antibody that targets the growth factor PGAM1. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. It specifically binds to the influenza hemagglutinin protein, preventing its interaction with host cells and inhibiting viral replication.</p>

<p>The cSRC antibody is a highly specialized monoclonal antibody that specifically targets the cSRC protein. This protein plays a crucial role in various cellular processes, including cell growth and proliferation. The cSRC antibody has been extensively studied and proven to be an effective inhibitor of the activated cSRC protein.</p>

<p>The S100A6 antibody is a protein that is widely used in life sciences research. It is a polyclonal antibody that specifically targets the S100A6 protein. This antibody has been shown to have low density binding to MCF-7 cells, making it ideal for use in various applications such as immunofluorescence, immunoprecipitation, and Western blotting. The S100A6 antibody has also been shown to interact with other proteins such as annexin A2 and fatty acid-binding protein, suggesting its involvement in diverse cellular processes. Additionally, this antibody has monoclonal counterparts available for specific applications. With its high specificity and sensitivity, the S100A6 antibody is an essential tool for studying the role of this protein in growth factor signaling pathways and cellular processes.</p>

<p>CD62L antibody (Azide Free) was raised in Rat using C3H/eb cloned mouse B lymphoma 38C-13 as the immunogen.</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>Purified recombinant TNF protein (Bovine) (His tag)</p>

<p>Rabbit polyclonal FRA1 antibody</p>

<p>GLUD1 antibody was raised in Rabbit using Human GLUD1 as the immunogen</p>

<p>Oxycodone antibody was raised in mouse using oxycodone-BSA as the immunogen.</p>

<p>Mouse monoclonal FBXO21 antibody</p>

<p>Recombinant Human HSPB6 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4F12 antibody, catalog no. 70R-7251</p>

<p>The FBP2 protein is a crucial component in the field of Life Sciences. It plays a significant role in various biological processes, including collagen synthesis and regulation. This protein consists of numerous amino acid residues that contribute to its anticoagulant properties. Additionally, FBP2 has been shown to modulate the levels of interleukin-6 (IL-6), a key pro-inflammatory cytokine.</p>

<p>ASPHD2 antibody was raised using the middle region of ASPHD2 corresponding to a region with amino acids YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL</p>

<p>IFN gamma antibody was raised in Mouse using recombinant human IFN-gamma (BioSource company, Cat.No. PHC4033) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AMACR antibody, catalog no. 70R-10187</p>

<p>TIAL1 antibody was raised in rabbit using the C terminal of TIAL1 as the immunogen</p>

<p>Rabbit polyclonal ABHD14B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNAI3 antibody, catalog no. 70R-9626</p>

<p>VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal BTRC antibody</p>

<p>Rabbit polyclonal SCNN1D antibody</p>

<p>Rabbit polyclonal NUDT19 antibody</p>

<p>TMEM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT</p>

<p>CD86 antibody (Azide free) was raised in rat using LPS-activated murine B cells as the immunogen.</p>

<p>The DUSP3 antibody is a highly specific monoclonal antibody that targets the dual specificity phosphatase 3 (DUSP3) protein. This antibody plays a crucial role in various biological processes, including cell growth, differentiation, and immune response regulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MOSPD3 antibody, catalog no. 70R-1823</p>

<p>GPNMB antibody was raised in Rabbit using Human GPNMB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PML antibody, catalog no. 70R-7965</p>

<p>Purified recombinant CNOT8 protein (His tag)</p>

<p>Mouse monoclonal HSPB1 antibody</p>

<p>ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV</p>

<p>BACH1 antibody was raised in Rabbit using Human BACH1 as the immunogen</p>

<p>Rabbit polyclonal HSL antibody (Ser552)</p>