Compuestos y reactivos bioquímicos

<p>CA2 antibody was raised in rabbit using the N terminal of CA2 as the immunogen</p>

<p>CD25 antibody is a drug that targets the IL-2 receptor, which is involved in immune system activation. It is an anti-CD25 antibody that has been developed as a potential treatment for various diseases, including cancer. CD25 antibody works by blocking the IL-2 receptor and preventing the binding of IL-2, a growth factor that stimulates the proliferation and activation of immune cells. This inhibition of IL-2 signaling can help regulate immune responses and potentially suppress autoimmune reactions. CD25 antibody is a monoclonal antibody, meaning it is produced from a single clone of cells and specifically targets the CD25 antigen on immune cells. It has shown promising results in preclinical studies and is being investigated as a potential therapeutic option in Life Sciences research. The use of CD25 antibody in combination with other drugs, such as histone deacetylase inhibitors or C-C chemokine receptor antagonists, may enhance its efficacy and provide additional benefits.</p>

<p>The Caspase 7 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. This monoclonal antibody is specifically designed to target and detect caspase 7, an important enzyme involved in programmed cell death (apoptosis). It is widely used in research laboratories and medical facilities for various applications, including studying apoptosis pathways, investigating neuroprotective mechanisms, and developing therapeutic strategies.</p>

<p>Rabbit polyclonal TTC39A antibody</p>

<p>Purified native Dengue Type 4 protein</p>

<p>Purified recombinant RPS16 protein (His tag)</p>

<p>Inhibitor of heat shock protein HSP90</p>

<p>LGMN protein is a monoclonal antibody that belongs to the group of conjugated proteins. It has neutralizing properties and can bind to specific targets in order to inhibit their activity. This antibody has been shown to be effective against acidic conditions and can neutralize interferon in human serum. LGMN protein also binds to angptl3, a protein involved in lipid metabolism, and can modulate its function. It is commonly used in research and diagnostic applications, as well as in the development of therapeutic agents. The antibody is typically conjugated with streptavidin for easy detection and purification. LGMN protein is stable when stored properly and does not require any special handling or storage conditions.</p>

<p>DDX27 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 27 (Ddx27)</p>

<p>Purified Polyclonal ELOVL1 antibody</p>

<p>Mouse monoclonal COX6A1 antibody</p>

<p>Armenian Hamster monoclonal FceRI alpha antibody (biotin)</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>ABCF1 antibody was raised in mouse using recombinant Transcription Factor Ap-2 Gamma (Activating Enhancer Binding Protein 2 Gamma) (Tfap2C)</p>

<p>The CIDEB antibody is a highly specialized reagent used in the field of Life Sciences. It is an affinity ligand that specifically binds to CIDEB protein, making it an essential tool for researchers studying hematopoietic cells and pluripotent stem cells. This polyclonal antibody can be used in various applications, including immunohistochemical analysis, protein detection, and inhibition studies.</p>

<p>ZIC5 antibody was raised in rabbit using the N terminal of ZIC5 as the immunogen</p>

<p>Complement C4a antibody was raised in rabbit using highly purified human complement protein as the immunogen.</p>

<p>ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen</p>

<p>Rabbit polyclonal PLC beta antibody</p>

<p>Recombinant Human HERPUD1 protein</p>

<p>GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA</p>

<p>The HSP60 antibody is a neuroprotective agent that belongs to the family of endothelial growth factors. It acts as a neurotrophic factor, promoting the growth and survival of neurons. This antibody is colloidal in nature and is widely used in Life Sciences research. It is a monoclonal antibody specifically designed to target and neutralize endothelial growth factor, which plays a crucial role in angiogenesis and vascular development. The HSP60 antibody can also be used to detect the presence of specific antigens, such as circumsporozoite protein, in biological samples. With its high specificity and sensitivity, this antibody is an essential tool for researchers studying various aspects of cell biology and immunology.</p>

<p>KLK12 antibody was raised in rabbit using residues 236-248 [KYVDWIRMIMRNN] of the human KLK12 protein as the immunogen.</p>

<p>Purified recombinant Hepatitis C Virus protein chimera</p>

<p>MGSSHHHHHH SSGLVPRGSH MEAQAQGLLE TEPLQGTDED AVASADFSSM LSEEEKEELK AELVQLEDEI TTLRQVLSAK ERHLVEIKQK LGMNLMNELK QNFSKSWHDM QTTTAYKKTH ETLSHAGQKA TAAFSNVGTA ISKKFGDMRR K</p>

<p>Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM</p>

<p>Purified recombinant NHLH2 protein (His tag)</p>

<p>KLHL13 antibody was raised in Mouse using a purified recombinant fragment of human KLHL13 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal CD295 antibody</p>

<p>Rabbit polyclonal CHST9 antibody</p>

<p>The CD89 antibody is a highly specialized polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and bind to the glial fibrillary acidic protein kinase, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying the levels of glial fibrillary acidic protein kinase in various biological samples.</p>

<p>Purified recombinant GLUD1 protein (His tag)</p>

<p>PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH</p>

<p>Rat monoclonal CD117 antibody (biotin)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>The RAB22A antibody is a highly specialized monoclonal antibody that targets the glycan structures found in human serum. This antibody has been extensively studied and has shown promising results in various areas of research, including cancer biology and immunology.</p>

<p>SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV</p>

<p>C16ORF48 antibody was raised using the C terminal Of C16Orf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV</p>

<p>MIF protein is a monoclonal antibody that specifically targets and neutralizes the activity of tumor necrosis factor-alpha (TNF-α). This protein has been extensively studied in the field of life sciences and is widely used in research applications. MIF protein is capable of binding to antigenic peptides and can be conjugated with other proteins for various experimental purposes. It has been shown to activate growth factors and inhibit the production of inflammatory cytokines. Additionally, MIF protein can be used in cytotoxic assays or as an electrode for polymerase chain reactions. Its inhibitory factor properties make it a valuable tool in studying angiopoietin-like 3 (ANGPTL3) and other related molecules.</p>

<p>Alkaline phosphatase antibody was raised in mouse using purified human placenta ALP as the immunogen.</p>

<p>Rabbit polyclonal WRKY62 antibody</p>

<p>Rabbit polyclonal VASH1 antibody</p>

<p>Mouse monoclonal RAD51B antibody</p>

<p>The S100P antibody is a monoclonal antibody that targets the protein S100P. S100P is a chemokine-like protein that has been implicated in various biological processes, including cell growth, differentiation, and inflammation. It is also associated with certain diseases, such as circovirus infection and cancer.</p>

<p>Mouse monoclonal C9orf41 antibody</p>

<p>Rabbit polyclonal Retinoblastoma antibody (Ser608)</p>

<p>The ALDOC antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets the ALDOC protein, which is involved in various cellular processes such as chemokine production, acetylation, and natriuretic regulation. This antibody can be used to study the expression and localization of ALDOC in different tissues and cell types.</p>

<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL</p>

<p>ZNF415 antibody was raised in rabbit using the C terminal of ZNF415 as the immunogen</p>

<p>SLC39A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE</p>

<p>Rabbit polyclonal GPR82 antibody</p>

<p>FGF16 antibody was raised in goat using highly pure recombinant human FGF-16 as the immunogen.</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>Mouse monoclonal LT alpha antibody</p>

<p>AP2A1 antibody was raised in rabbit using the C terminal of AP2A1 as the immunogen</p>

<p>KHDRBS1 antibody was raised using the middle region of KHDRBS1 corresponding to a region with amino acids PPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSY</p>

<p>SH2B1 antibody was raised using the middle region of SH2B1 corresponding to a region with amino acids GTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSD</p>

<p>Rat monoclonal CD11a antibody (PE)</p>

<p>mTORC1/2 inhibitor</p>

<p>Rat monoclonal CD49f antibody (biotin)</p>

<p>Rabbit polyclonal Caspase 9 antibody (Thr125)</p>

<p>CK2 alpha antibody was raised using the C terminal of CSNK2A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD</p>

<p>Mouse monoclonal UBE2E3 antibody</p>

<p>RAD17 antibody was raised in rabbit using residues 2-15 [NQVTDWVDPSFDDF] of the human RAD17 protein as the immunogen.</p>

<p>Rabbit polyclonal STX8 antibody</p>

<p>Rabbit polyclonal ABL1 antibody (Thr735)</p>

<p>Mouse monoclonal NLN antibody</p>

<p>MCM8 antibody was raised in Rabbit using Human MCM8 as the immunogen</p>

<p>The ALK antibody is a powerful tool in the field of Life Sciences. This antibody is specifically designed to target and bind to ALK (anaplastic lymphoma kinase), a protein that plays a crucial role in cell growth and division. By binding to ALK, this antibody can help researchers study its function and investigate its involvement in various diseases.</p>

<p>The CLPP antibody is a highly specialized biomolecule that belongs to the class of monoclonal antibodies. It specifically targets chemokine binding proteins and has been widely used in life sciences research. This monoclonal antibody has a high affinity for its target and can be used for various applications, including immunoassays, protein detection, and cell signaling studies. The CLPP antibody has been shown to have cytotoxic effects on activated cells and can be used as a tool for targeted therapy. It can also be immobilized on electrodes or collagen matrices for use in biosensors or tissue engineering applications. With its exceptional specificity and versatility, the CLPP antibody is an invaluable tool in the field of molecular biology and biomedical research.</p>

<p>MLF2 antibody was raised in Rabbit using Human MLF2 as the immunogen</p>

<p>The eNOS antibody is a highly specialized antibody used in the field of Life Sciences. It has been extensively studied and proven to have significant cation binding properties. Through molecular docking, it has shown a strong affinity for epidermal growth factor (EGF), making it an essential tool for researchers studying EGF-related pathways.</p>

<p>Recombinant Human LAP3 protein (His tag)</p>

<p>GPR44 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>SSE15206 is a chemical compound commonly referred to as an intermediate in organic synthesis. It is derived from complex chemical precursors through an extensive series of reactions involving catalysts and controlled conditions. This compound serves a pivotal role in the synthetic pathway by enabling the construction of more intricate molecules.</p>

<p>SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.</p>

<p>The F3 antibody is a potent cytotoxic and inhibitory factor used in Life Sciences. It targets various proteins and molecules such as tyrosinase, insulin, collagen, and fibronectin. This antibody has been extensively studied for its ability to neutralize autoantibodies and anti-ACTH antibodies. The F3 antibody is highly specific and can be used in a wide range of applications including research, diagnostics, and therapeutics. Its unique properties make it an essential tool for studying protein-protein interactions, cell signaling pathways, and immune responses. With its high affinity and specificity, the F3 antibody offers researchers unparalleled accuracy and reliability in their experiments.</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>The PYCR2 protein is a growth factor that plays a crucial role in neutralizing interferon. It is widely used in the field of Life Sciences for various applications. PYCR2 protein has been extensively studied and its binding proteins are well characterized. It is commonly used as a target for antibody-drug conjugates, monoclonal antibodies, and other therapeutic agents. PYCR2 protein is often purified from liver microsomes and can be used in research studies to investigate its interaction with other molecules such as globulins, chemokines, and anti-CD20 antibodies. This highly purified protein is free from any excipients and has a high refractive index, making it ideal for use in experiments requiring precise measurements.</p>

<p>Rat monoclonal Flk 1 antibody (allophycocyanin)</p>

<p>TRF3 antibody was raised in rabbit using the N terminal of TRF3 as the immunogen</p>

<p>The NRF2 antibody is a highly effective tool in the field of immunology and molecular biology. This antibody belongs to the class of polyclonal antibodies, which are produced by multiple B cell clones and have the ability to recognize different epitopes on the target protein. The NRF2 antibody specifically targets the nuclear factor erythroid 2-related factor 2 (NRF2), a transcription factor that plays a crucial role in cellular defense against oxidative stress.</p>

<p>Complement C3 protein is a test compound that plays a crucial role in the immune system. It is involved in various processes such as inflammation, opsonization, and immune complex clearance. Complement C3 protein interacts with IFN-gamma and is found to have intraocular effects. This protein is commonly used in research and diagnostic applications in the field of Life Sciences. It has been shown to exhibit neutralizing properties against autoantibodies and can be used for studying interferon and chemokine signaling pathways. Additionally, complement C3 protein has been implicated in endothelial growth factor regulation, making it an important target for therapeutic interventions related to angiogenesis. Its high viscosity allows for easy handling during experiments.</p>

<p>The CYP19 antibody is a highly specialized antibody that targets the aromatase enzyme, also known as cytochrome P450 19A1. This enzyme plays a crucial role in the synthesis of estrogen, making it an important target in hormone-related diseases and conditions. The CYP19 antibody specifically binds to the aromatase enzyme, inhibiting its activity and preventing the conversion of androgens into estrogens. This can have significant therapeutic implications in the treatment of hormone-dependent cancers such as breast cancer. Additionally, the CYP19 antibody has been used in research settings to study the regulation of estrogen synthesis and its impact on various physiological processes. With its high specificity and affinity for the aromatase enzyme, the CYP19 antibody is a valuable tool for both clinical and scientific applications in the field of endocrinology and oncology.</p>

<p>LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL31 antibody, catalog no. 70R-6296</p>

<p>FOXA1 antibody is a monoclonal antibody that specifically targets β-catenin, a protein involved in various cellular processes. This antibody acts as a family kinase inhibitor, blocking the activity of kinases that regulate β-catenin signaling. It is widely used in life sciences research to study the role of β-catenin in development, cancer, and other diseases.</p>

<p>ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA</p>

<p>Beta galactosidase antibody was raised in rabbit using beta galactosidase (E. Coli) as the immunogen.</p>

<p>BTF3L1 antibody was raised in rabbit using the n terminal of BTF3L1 as the immunogen</p>

<p>Purified Rabbit polyclonal LETMD1 antibody</p>

<p>PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL</p>

<p>NOSIP antibody was raised using the N terminal of NOSIP corresponding to a region with amino acids LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Studies have shown its high efficacy on human erythrocytes using a patch-clamp technique.</p>

<p>KIF5A antibody was raised using the middle region of KIF5A corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH</p>

<p>FABP3 protein is a growth factor that plays a crucial role in various biological processes. It can be activated by specific antibodies present in human serum, leading to the promotion of anti-angiogenesis activities. FABP3 is a glycoprotein that binds to fatty acids and facilitates their transport within cells. This protein can be detected using streptavidin-coated electrodes or colloidal gold-labeled antibodies. FABP3 is widely used in Life Sciences research as a target for studying cellular metabolism and lipid signaling pathways. Additionally, it serves as a valuable tool for developing inhibitors and monoclonal antibodies for therapeutic applications.</p>

<p>Purified recombinant ASPHD1 protein (His tag)</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR</p>

<p>Ciita antibody was raised in rabbit using CIITA peptide corresponding to a region near the N-terminus of the human protein conjugated to KLH as the immunogen.</p>