Compuestos y reactivos bioquímicos

<p>This antibody is a rabbit polyclonal antibody against human amyloid beta protein. It has been shown to bind to the major type of amyloid beta peptide and is recommended for use in Western blotting, immunoprecipitation and immuno-fluorescence as well as other applications. This antibody will not cross-react with other proteins in human tissue samples.</p>

<p>CD19 antibody (FITC) was raised in mouse using human CD19 as the immunogen.</p>

<p>3-Benzoylcoumarin is a derivative of 3-acetylcoumarin and 4-hydroxycoumarin. It has been postulated that this compound may have anticancer activity. The cancer cells are sensitive to inhibition by 3-benzoylcoumarin, which is mediated by the glutamic acid pathway. 3-Benzoylcoumarin has shown antibacterial activity against Escherichia coli and Staphylococcus aureus. This drug also exhibits fluorescence properties, which can be used as a probe for the detection of bacteria in water samples or as an antibacterial agent in water purification methods.</p>

<p>CD107a antibody (FITC) was raised in rat using murine CD107a (LAMP-1) as the immunogen.</p>

<p>CD94 antibody (FITC) was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.</p>

<p>Gefitinib-d3 is a potent inhibitor of the protein kinase activity of the epidermal growth factor receptor (EGFR). It is used in medicinal chemistry research to study the mechanisms of apoptosis and cell cycle regulation. Gefitinib-d3 inhibits cyclin-dependent kinases, which play a key role in tumor growth and proliferation. This drug has been shown to be effective against several types of human cancer, including leukemia, lung cancer, and breast cancer. It works by blocking the signals that stimulate cell growth and division, leading to the death of cancer cells. Gefitinib-d3 is an important tool for researchers studying the molecular mechanisms underlying cancer development and progression.</p>

<p>CD22 antibody (biotin) was raised in rat using CD22 as the immunogen.</p>

<p>Napitane is a peptide that is used as a research tool in the field of cell biology and pharmacology. It can be used to study protein interactions by acting as an inhibitor of the receptor or ligand. Napitane has been shown to inhibit ion channels, which are membrane proteins that regulate ion flow across the cell membrane. It also inhibits the opening of calcium channels, leading to decreased neurotransmitter release in cells. Napitane is a highly potent inhibitor with high purity and a CAS number of 148152-63-0.</p>

<p>Adalimumab is a monoclonal antibody that binds to TNF-α, a proinflammatory cytokine. It is used in the treatment of inflammatory bowel disease and other autoimmune diseases. Adalimumab has been shown to be effective in clinical trials of patients with Crohn's disease and ulcerative colitis. This is research biosimilar for R&amp;D use only.</p>

<p>IL 13 Mouse is a recombinant mouse IL-13 protein that binds to the IL-4 receptor. This recombinant protein is used as a research tool in pharmacology and cell biology. It can be used in the study of protein interactions and the activation of cells by cytokines.</p>

<p>MSN-125 is a peptide that is an activator of the human G-protein coupled receptor MSN2. MSN-125 has been shown to activate the receptor by binding to it, leading to activation of downstream signaling pathways. MSN-125 can also inhibit protein interactions and may be used as a research tool for studying the function of ion channels and their role in cell biology.</p>

<p>CD19 antibody (Azide free) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>CEP1, C-Terminally Encoded Peptide 1 is involved in the regulation of plant growth and abiotic stress through cellular communication.</p>

<p>A synthetic antimicrobial peptide whose sequence is derived from the Fungus, Pseudoplectania nigrella. This product has disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39 and is available as a hydrochloride salt and as a 0.1mg vial.<br>One letter code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY</p>

<p>C Reactive Protein Heavy Tryptic Peptide Standard for protein identification and quantitation studies. C-reactive protein is an acute phase protein present in blood plasma and is produced by the liver. During inflammation levels of c-reactive protein increase and therefore it can be a useful protein to indicate an infection is present.</p>

<p>DOTA-tris(TBE)-Amido-dPEG®4-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(TBE)-Amido-dPEG®4-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Boc-Leu-Thr-Arg-AMC is a fluorescent ligand used in research as a tool to study ion channels. It is a peptide that activates the receptor, which can be used to inhibit the channel and its function. This compound has high purity and is an inhibitor of ion channels.</p>

<p>Enzyme that catalyzes the formation of disulfide bonds in proteins</p>

<p>TentaGel® XV RAM is a particle-based reagent for peptide synthesis. It contains the building blocks for peptides and has been designed to be used in conjunction with a TentaGel® XV reactor. This product is designed to increase the yield of peptides via the use of a patented process that eliminates the need for purification and can reduce reaction time by up to 50%.</p>

<p>3-[4-[(1,3-Benzodioxol-5-ylmethyl)amino]-4-oxobutyl]-N-(3-chlorophenyl)-3,4-dihydro-2,4-dioxo-1(2H)-quinazolineacetamide is a synthetic quinazoline derivative, developed for research and pharmaceutical purposes. This compound originates from a sophisticated chemical synthesis process involving the modification of quinazoline cores, which are well-known for their pharmacological activities. Its mode of action likely involves the inhibition of specific enzymatic pathways or receptor binding, typical of quinazoline compounds that interact with targets such as protein kinases or receptors involved in cellular growth and differentiation.</p>

<p>Please enquire for more information about 5,6,7,8,9-Dehydro-10-desmethyl finasteride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hepatitis B virus e-antigen recombinant is a vaccine that contains the hepatitis B virus surface antigen. The recombinant vaccine is produced by Escherichia coli and is purified by chromatography. It has been shown to be immunoreactive in humans and has a minimal viral load of less than 0.001 plaque-forming units per milliliter. The recombinant vaccine has been shown to be safe, as it does not cause any adverse reactions or side effects.</p>

<p>Please enquire for more information about 6-[D10]Leu-Glargine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Atogepant is a drug for the treatment of migraine that belongs to the group of anti-migraine drugs. It has been shown to inhibit the synthesis of cholesterol, which may be one of its mechanisms for prevention of migraines. Atogepant also inhibits microbial infections through inhibition of growth and can be used as a prophylactic agent against bacterial and viral infections. Atogepant is not active against fungi or parasites. The drug has been observed to have few side effects in women, and it does not affect liver function. It is thought that atogepant binds to a receptor on trigeminal nerve cells, which leads to activation of these cells and subsequent relief from migraine pain.</p>

<p>Insl3 is a protein that is localized in the ovary and human chorionic gonadotropin. It is also found in human serum. In animals, Insl3 causes fertility. In humans, it stimulates the development of the gubernaculum, which attaches to the testes. The expression of Insl3 increases during puberty and continues to be expressed throughout adulthood. Insl3 is translated from mRNA as a precursor protein with an N-terminal signal peptide sequence that directs its secretion from the cell into the extracellular space. The Insl3 precursor protein has two C-terminal domains: an internal domain and a carboxy-terminal domain. These domains are translated from separate initiation codons on one mRNA molecule. The internal domain contains sequences for translation initiation, ribosome binding sites, and translational stop codons; these sequences are not present in the carboxy-terminal domain. Insl3 can be detected by using an</p>

<p>Alpha-1-Acid Glycoprotein light tryptic peptide standard for protein identification and quantitation. Alpha-1-Acid Glycoprotein is an acute phase protein whose concentration in serum increases during, infection, inflammation and tissue injury.</p>

<p>[D-Ala2,Met5]-Enkephalinamide is a peptide that belongs to the group of opioid peptides. It acts as an agonist and binds to the µ-opioid receptor. This receptor is involved in transmitting signals from outside the cell to inside the cell by regulating ion channels and controlling protein interactions. The binding of [D-Ala2,Met5]-Enkephalinamide to this receptor results in an inhibitory effect on neurotransmitter release, leading to a decrease of pain sensation. It has also been shown that [D-Ala2,Met5]-Enkephalinamide can act as an antagonist at other opioid receptors, such as the κ-opioid receptor.</p>

<p>GM-CSF is a cytokine that stimulates the production of neutrophils, macrophages, and other cells of the immune system. GM-CSF is a glycoprotein with a molecular weight of about 26 kD. It has been purified from human blood by RP-HPLC and found to have a sequence of 551 amino acids. The protein is active as freeze dried material or after desiccation at -70°C for 12 months. GM-CSF is commercially available in lyophilized form (Cytokine) or as recombinant proteins (Proteins).</p>

<p>Cathepsin-D is a protease enzyme that belongs to the family of aspartic proteases. It is involved in the degradation of proteins, lipids, and carbohydrates. Cathepsin-D can be found in a variety of tissues, including lung, pancreas, and brain. Inhibition assays have been used to determine the inhibition activity against human cathepsin-D.</p>

<p>EGF is a protein that belongs to the epidermal growth factor family. It has been shown to be an activator of the receptor tyrosine kinase, and binds to the extracellular domain of the receptor with high affinity. EGF is a ligand for the epidermal growth factor receptor (EGFR), and it has been shown that there are many other receptors that can bind to EGF, including insulin-like growth factor 1 receptor (IGF1R), insulin-like growth factor 2 receptor (IGF2R), platelet-derived growth factor A receptor alpha chain (PDGFRα), c-met proto-oncogene, fibroblast growth factor receptor 3 (FGFR3), and nerve growth factor receptor (NGFR). EGF also activates ion channels such as TRPC6 and TRPV4, which are involved in cell proliferation and differentiation.</p>

<p>N-Desmethyltrimeprazine hydrochloride is a chemical compound that serves as a metabolite and derivative of trimeprazine, an antihistamine and antipsychotic. This compound is synthesized through the metabolic demethylation of trimeprazine, originating primarily from pharmacological studies involving trimeprazine and its derivatives. The compound exhibits an affinity for histamine and dopamine receptors, contributing to its pharmacodynamic properties. Its mode of action hinges on antagonistic activity at these receptor sites, influencing neurotransmitter pathways to modulate physiological processes.The primary application of N-Desmethyltrimeprazine hydrochloride lies in its utility as a research tool within pharmacological studies, particularly focusing on receptor binding assays and drug metabolism investigations. Understanding its interaction with histamine and dopamine receptors aids in elucidating the pharmacokinetics and pharmacodynamics of trimeprazine-related compounds. Furthermore, its study provides insights into the metabolism of psychotropic drugs, enhancing the development and optimization of therapeutic agents in neuropsychiatric treatment.</p>

<p>Peptide H-IENYTPDLPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLSATDTLDEAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AMDAIFGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NLYDIGEQLDSEDLASLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-HSLLDEGKQSLTKLA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Boc-SC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Human Natriuretic peptides A (NPPA) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EDVYVVGTVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HHHHHHLPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Azidoindolene 1 is a cytotoxic drug that targets tumor cells. It is a microbial natural product that has been shown to have anti-inflammatory and immunosuppressive properties. This compound also shows broad-spectrum antimicrobial activity against various microbial pathogens, such as Gram-positive and Gram-negative bacteria, fungi, and viruses. Azidoindolene 1 binds to cannabinoid receptors in the cell membrane of target cells and inhibits the growth of cancer cells by inducing apoptosis. This compound has been shown to be effective against tumors in mice with an experimental colon cancer model. Azidoindolene 1 also has potential as an immunogen for the treatment of autoimmune diseases and infections.</p>

<p>Peptide H-LSPSFADLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Hepcidin-1 (mouse) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LAQEAGNFERISGDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLDDYNHLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MESSAKRKMDPDNPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EANQSTLENFLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LHQLAFDTYQEFEEAYIPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KLYDPLYHPSM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AYSLFSYNTQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Cathepsin D antibody is a polyclonal antibody that specifically targets and neutralizes the activity of Cathepsin D. This enzyme plays a crucial role in various cellular processes, including growth factor receptor binding, phosphatase activity, and adipose tissue development. The Cathepsin D antibody is derived from human serum and has been extensively tested for its efficacy in various experimental settings.</p>

<p>Peptide Ac-SGRGKQGGKAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.</p>

<p>Peptide H-LPFFSNVTWF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SIRLPGCPRGVNPVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-QGYFVEAQPK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide PEP1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LQEYTQTILR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-FIFYLKNIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IEELEEEIEAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HWGMWSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Melanoma-overexpressed antigen 1 (36-44) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>GAP is a natural peptide that has been found to bind to the G protein coupled receptor (GPCR) known as gonadotropin-releasing hormone receptor (GnRH-R). This receptor is linked to ion channels and plays a role in many different biological processes, including cell division and growth. GAP can be used as a research tool for studying how cells work. It can also be used in pharmacology studies, such as determining the effect of GAP on the activity of ion channels or protein interactions.</p>

<p>Thymosin, beta 10 (human, rat) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-PVLDLFRELLNELLEALKQKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CD3e antibody (Spectral Red) was raised in mouse using porcine CD3e as the immunogen.</p>

<p>Peptide H-RRRRRRRRRC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YLDEIPPKF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSEPAEITDAVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>MUC1(126-149)-Tn (140) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VVGGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VVAPRTLVL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>CMVpp65 - 72 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>ICA-069673 is a drug that can be used for the treatment of seizures. It has been shown to bind to and block voltage-gated potassium channels, as well as ligand-gated ion channels such as the GABA receptor. ICA-069673 also binds to intracellular calcium (Ca2+) channels and inhibits Ca2+ influx, leading to an anti-epileptic effect. Animal research has shown that ICA-069673 may have a therapeutic effect on bladder function.</p>

<p>H-CSRNLIDCGGGDGGCSRNLIDC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>CMVpp65 - 21 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide SARS-CoV-2 Antigen Peptide NCAP (LALLLLDRL) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Neuromedin-U-23 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-AFLPGMNPPPYSQFLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ambucetamide is a water-soluble, biocompatible polymer that is designed to bind to receptors in the body. It has potential as a biomarker due to its ability to bind with high affinity and selectivity to various types of cells. Ambucetamide also binds strongly with water vapor and light emission, which may be useful for cancer therapy or other biomedical applications. The toxicity of ambucetamide has been studied in rats at high concentrations. In addition, the compound was shown to be nontoxic in a study of pluripotent cells. Experiments have also shown that ambucetamide can inhibit leukemia inhibitory factor (LIF) from binding with cell surface receptors on human leukemia cells and induce an antitumor response.<br>The compound is also composed of nitrogen atoms, sodium citrate, fatty acid, and inorganic acid groups, which are used as catalysts for reactions such as solid-phase acid catalysis and ionic liquid catalysis.</p>

<p>Sarcotoxin IA is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Inhibitor of PI3Kγ kinase</p>

<p>CMVpp65 - 64 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Estradiol 3-sulfamate is a synthetic estrogen analogue, which is derived from the natural estrogen hormone, estradiol. Its mode of action involves the inhibition of steroid sulfatase, an enzyme responsible for converting sulfated steroid precursors into active estrogens. This inhibition reduces estrogen levels and influences the hormonal regulation pathways within the body.</p>

<p>CD19 antibody (PE-Texas Red) was raised in mouse using human CD19 as the immunogen.</p>

<p>CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.</p>

<p>Peptide H-LLEVPEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>LEAP-2 (38 - 77) (Human) is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about KYT-36 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CD166 antibody (biotin) was raised in mouse using human thymic epithelial cells as the immunogen.</p>

<p>CD19 antibody (FITC) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.</p>

<p>WZ4141 is a small molecule compound, which functions as a potent modulator of specific biological pathways. This compound is synthetically derived, offering researchers precise control over its experimental applications. It operates by selectively targeting and altering molecular interactions within cells, thereby influencing various signaling pathways that are critical for cellular functions.</p>

<p>CD5 antibody (PE) was raised in rat using CD5/Lyt-1 as the immunogen.</p>

<p>Ribalinium chloride is an anticancer drug that works by inhibiting the activity of protein kinases, which are enzymes involved in cell division and growth. It has been shown to be effective against a variety of cancer types, including leukemia and tumors. Ribalinium chloride induces apoptosis, or programmed cell death, in cancer cells by blocking the cell cycle and preventing them from dividing further. It is derived from Chinese medicinal plants and has been used traditionally for its anti-tumor properties. Ribalinium chloride is excreted mainly through urine and acts as a potent inhibitor of protein kinase activity. This makes it a promising candidate for the development of new cancer treatments that target specific signaling pathways involved in tumor growth and progression.</p>

<p>Estreptoquinasa is an inhibitor of protein interactions. It binds to the ligand-binding domain of a receptor, blocking the interaction with its natural ligand. This inhibition prevents the receptor from activating downstream signaling pathways, which leads to a decrease in cellular activity. Estreptoquinasa has been shown to be an effective inhibitor of ion channels and can be used as a research tool for studying ion channel biology.</p>

<p>Complement C3 antibody (Fab'2) was raised in goat using purified complement C3 isolated from human plasma as the immunogen.</p>

<p>GW604714X is a medicinal compound that belongs to the family of kinase inhibitors. It has been shown to have potent anticancer properties and can induce apoptosis in human cancer cells. GW604714X is an analog of a protein kinase inhibitor and has been found to be effective in inhibiting tumor growth. This compound has been extensively studied for its ability to target specific kinases involved in cancer cell proliferation. GW604714X has shown promising results in preclinical studies as a potential treatment for various types of cancers, including Chinese hamster ovary (CHO) cells. The compound is detectable in urine, making it a potential biomarker for monitoring treatment response.</p>

<p>CD28 antibody (FITC) was raised in mouse using chicken CD28 as the immunogen.</p>