Compuestos y reactivos bioquímicos

<p>Rabbit polyclonal Luteinizing Hormone antibody (Prediluted for IHC)</p>

<p>FBXO9 antibody was raised in Rabbit using Human FBXO9 as the immunogen</p>

<p>Purified Rabbit polyclonal PTGDR antibody</p>

<p>The XAF1 antibody is a high-quality monoclonal antibody that specifically binds to XAF1 protein, an important regulator of apoptosis. This antibody can be used for the treatment and/or prophylaxis of various diseases, including cancer. The XAF1 antibody has been extensively tested in both in vitro and in vivo studies, demonstrating its efficacy in inducing apoptosis in cancer cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD2C antibody, catalog no. 70R-7961</p>

<p>GATA3 antibody was raised in Rat using Mouse GATA-3 as the immunogen.</p>

<p>Rabbit polyclonal ATP5I antibody</p>

<p>NFKB p65 antibody was raised in Mouse using a purified recombinant fragment of human NF kappa B p65 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal WASP antibody</p>

<p>The GPRC5A antibody is a monoclonal antibody that specifically targets transthyretin, an antigen found in human hepatocytes. This antibody is widely used in the field of Life Sciences for various applications, including research assays and as a tool for studying growth factors. The GPRC5A antibody has been shown to effectively bind to transthyretin and inhibit its activity. It contains specific amino acid residues that enable it to recognize and bind to the target antigen with high affinity. This monoclonal antibody can be used in both activated and non-activated forms, making it versatile for different experimental conditions. In addition, the GPRC5A antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. With its ability to selectively target transthyretin, the GPRC5A antibody is a valuable tool in the study of this protein and its role in various biological processes.</p>

<p>NNT1 antibody was raised in rabbit using highly pure recombinant human NNT-1/BCSF-3 as the immunogen.</p>

<p>Goat anti-rat IgM was raised in goat using rat IgM mu chain as the immunogen.</p>

<p>Purified recombinant RAB13 protein</p>

<p>The Cortactin antibody is a highly effective tool for researchers and scientists in the field of life sciences. This monoclonal antibody specifically targets cortactin, a protein involved in cell growth and migration. It can be used to study the role of cortactin in various cellular processes, including epidermal growth factor signaling and interferon gamma activation.</p>

<p>Goat anti-rabbit IgG antibody was raised in goat using rabbit IgG as the immunogen.</p>

<p>Rabbit polyclonal MED8 antibody</p>

<p>Purified recombinant KRT17 protein (His tag)</p>

<p>ApoE protein is a neutralizing protein that can be targeted by lysine-specific monoclonal antibodies, such as trastuzumab. It plays a crucial role in various biological processes, including the regulation of cholesterol metabolism and the clearance of amyloid-beta plaques in Alzheimer's disease. ApoE protein is also involved in the modulation of epidermal growth factor receptor (EGFR) signaling and acts as a family kinase inhibitor. Additionally, it interacts with growth factors like urokinase plasminogen activator (uPA) and chemokines to regulate cell migration and inflammation. The use of antibodies against ApoE protein has been studied extensively, and their efficacy has been confirmed through spectrometric analysis. These antibodies have shown promise as potential therapeutics for targeting diseases associated with abnormal ApoE function, such as cardiovascular diseases and neurodegenerative disorders.</p>

<p>The VEGFB antibody is a highly specialized monoclonal antibody that has neutralizing properties against vascular endothelial growth factor B (VEGFB). It is commonly used in the field of Life Sciences for research purposes. This antibody works by binding to VEGFB and inhibiting its activity, which plays a crucial role in angiogenesis and blood vessel formation.</p>

<p>Purified recombinant TADA3 protein (His tag)</p>

<p>SETD4 antibody was raised in rabbit using the C terminal of SETD4 as the immunogen</p>

<p>1-349 amino acids: MGSSHHHHHH SSGLVPRGSH MKGLYFQQSS TDEEITFVFQ EKEDLPVTED NFVKLQVKAC ALSQINTKLL AEMKMKKDLF PVGREIAGIV LDVGSKVSFF QPDDEVVGIL PLDSEDPGLC EVVRVHEHYL VHKPEKVTWT EAAGSIRDGV RAYTALHYLS HLSPGKSVLI MDGASAFGTI AIQLAHHRGA KVISTACSLE DKQCLERFRP PIARVIDVSN GKVHVAESCL EETGGLGVDI VLDAGVRLYS KDDEPAVKLQ LLPHKHDIIT LLGVGGHWVT TEENLQLDPP DSHCLFLKGA TLAFLNDEVW NLSNVQQGKY LCILKDVMEK LSTGVFRPQL DEPIPLYEAK VSMEAVQKNQ GRKKQVVQF</p>

<p>The Telomerase antibody is a highly specialized inhibitor that targets the enzyme telomerase, which plays a crucial role in cell division and the maintenance of telomeres. This monoclonal antibody specifically binds to telomerase and inhibits its activity, making it an effective tool for studying telomere biology and potential therapeutic applications.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:</p>

<p>P4HB antibody was raised using the C terminal of P4HB corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD</p>

<p>The Histone H4 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and binds to the nuclear chromatin, allowing for the detection and analysis of histone H4 protein. This antibody has been widely used in various applications, including immunocytochemical localization and immunohistochemical detection.</p>

<p>Rat monoclonal CD41 antibody (FITC)</p>

<p>Rabbit polyclonal PLANH1 antibody (FITC)</p>

<p>JAKMIP2 antibody was raised in rabbit using the C terminal of JAKMIP2 as the immunogen</p>

<p>GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL</p>

<p>Esrra antibody was raised in rabbit using the C terminal of Esrra as the immunogen</p>

<p>Carboxypeptidase N2 antibody was raised using the N terminal of CPN2 corresponding to a region with amino acids FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL</p>

<p>Purified recombinant Human MSRB3 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385B antibody, catalog no. 70R-8995</p>

<p>MAP1S antibody was raised in Rabbit using Human MAP1S as the immunogen</p>

<p>MPG antibody was raised using the C terminal of MPG corresponding to a region with amino acids LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA</p>

<p>CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE</p>

<p>TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL</p>

<p>PNRC1 antibody was raised in rabbit using the middle region of PNRC1 as the immunogen</p>

<p>Rabbit polyclonal CYB5 antibody (HRP)</p>

<p>The RAB5B antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets RAB5B, a protein involved in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and immunoprecipitation.</p>

<p>Rabbit polyclonal HMGB1 antibody (biotin)</p>

<p>Region of BD2 protein corresponding to amino acids GIGDPVTCLK SGAICHPVFC PRRYKQIGTC GLPGTKCCKK P.</p>

<p>MAGEB4 antibody was raised in Rabbit using Human MAGEB4 as the immunogen</p>

<p>Rabbit polyclonal BHLHB3 antibody</p>

<p>The PAPPA antibody is a highly specialized DNA aptamer that specifically targets collagen and alpha-fetoprotein. This monoclonal antibody has been extensively used in the field of life sciences for ultrasensitive detection of these biomarkers. The PAPPA antibody is known for its high affinity and specificity, making it an excellent tool for research and diagnostic purposes. It can be utilized in various applications, including immunoassays, immunohistochemistry, and western blotting. With its ability to bind to specific targets with exceptional precision, the PAPPA antibody offers researchers a reliable and efficient means of studying the role of collagen and alpha-fetoprotein in various biological processes. Whether you are studying protein interactions or developing a DNA vaccine, this monoclonal antibody will undoubtedly enhance your research capabilities.</p>

<p>The TAU antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to fatty acids in the nucleus, allowing researchers to study their role in various cellular processes. Additionally, the TAU antibody has shown promising results as an anti-VEGF (vascular endothelial growth factor) therapy, inhibiting the growth of blood vessels and potentially offering new treatment options for diseases such as cancer. Furthermore, this antibody has been found to interact with natriuretic hormones and fibroins, suggesting its involvement in regulating blood pressure and tissue repair. In laboratory studies, the TAU antibody has demonstrated its ability to inhibit caspase-9 activity, a key enzyme involved in programmed cell death. With its high specificity and versatility, the TAU antibody is a valuable tool for researchers seeking to unravel the complexities of cellular pathways and develop novel therapeutic strategies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TERF2 antibody, catalog no. 20R-1063</p>

<p>Rat albumin protein is a native protein and antigen that can be used for various research purposes. It is commonly used in studies involving monoclonal antibodies, dopamine, teriparatide, cytotoxicity assays, nuclear receptor binding assays, and more. This protein is also useful in the development of oral haloperidol formulations and as a control in experiments involving ornithine, TNF-α, transferrin, and interleukin-6. With its diverse applications and high-quality composition, rat albumin protein is an essential biomolecule for researchers looking to study protein complexes and other related areas.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>ASF1A antibody was raised in Rabbit using Human ASF1A as the immunogen</p>

<p>Rabbit polyclonal EDG7 antibody</p>

<p>LAMP1 antibody was raised in rabbit using the N terminal of LAMP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF38 antibody, catalog no. 70R-1061</p>

<p>Purified Polyclonal CD51 HC antibody</p>

<p>The TAU antibody is a medicament that belongs to the class of monoclonal antibodies. It specifically targets and binds to the activated IL-1 receptor, inhibiting its activity and reducing inflammation. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas. The TAU antibody is buffered to maintain stability and potency during storage and transportation. It can be used in experiments involving hybridization, immunohistochemistry, or Western blotting. This specific antibody has been isolated from human serum and is highly purified for optimal performance. Additionally, it has been tested for its specificity and functionality to ensure reliable results. Whether you are conducting research or developing therapeutic applications, the TAU antibody is an essential tool for your scientific endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HSZFP36 antibody, catalog no. 20R-1274</p>

<p>The GAB2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including cation channel regulation and antigen-antibody reactions. This antibody specifically targets the activated form of platelet fibrinogen, which is essential for blood clotting.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOBEC4 antibody, catalog no. 70R-3301</p>

<p>The RanGAP1 Antibody is a high-quality monoclonal antibody that specifically targets the human protein, RanGAP1. This antibody is designed to neutralize the activity of RanGAP1, which plays a crucial role in various cellular processes such as cell division and growth factor signaling. The RanGAP1 Antibody has been extensively tested and validated for its specificity and high affinity towards RanGAP1.</p>

<p>Purified Polyclonal EIF3F antibody</p>

<p>This antibody reacts with heavy chains on Goat IgG.</p>

<p>Rabbit polyclonal ZNF384 antibody (biotin)</p>

<p>The DNA PKcs antibody is a powerful tool used in the field of Life Sciences. This antibody specifically targets and detects DNA-dependent protein kinase catalytic subunit (DNA PKcs), an enzyme involved in repairing damaged DNA. It has been extensively studied and proven to be effective in various research applications.</p>

<p>1-407 amino acids: MGSSHHHHHH SSGLVPRGSH MVNEYKKILL LKGFELMDDY HFTSIKSLLA YDLGLTTKMQ EEYNRIKITD LMEKKFQGVA CLDKLIELAK DMPSLKNLVN NLRKEKSKVA KKIKTQEKAP VKKINQEEVG LAAPAPTARN KLTSEARGRI PVAQKRKTPN KEKTEAKRNK VSQEQSKPPG PSGASTSAAV DHPPLPQTSS STPSNTSFTP NQETQAQRQV DARRNVPQND PVTVVVLKAT APFKYESPEN GKSTMFHATV ASKTQYFHVK VFDINLKEKF VRKKVITISD YSECKGVMEI KEASSVSDFN QNFEVPNRII EIANKTPKIS QLYKQASGTM VYGLFMLQKK SVHKKNTIYE IQDNTGSMDV VGSGKWHNIK CEKGDKLRLF CLQLRTVDRK LKLVCGSHSF IKVIKAKKNK EGPMNVN</p>

<p>The GDF15 antibody is a highly effective monoclonal antibody that has neutralizing properties against prorenin. It is widely used in Life Sciences research and assays. This antibody specifically targets the CD20 antigen and has been proven to be highly effective in inhibiting its activity. Additionally, the GDF15 antibody has colloidal properties, making it easy to work with in laboratory settings. It also possesses inhibitory effects on glucose-6-phosphate and sclerostin, making it a versatile tool for various applications. With its high specificity and potency, the GDF15 antibody is a valuable asset for researchers working with antigens and seeking reliable results.</p>

<p>Purified Polyclonal SMAD2/3 antibody</p>

<p>Region of Resistin protein corresponding to amino acids SSMPLCPIDE AIDKKIKQDF NSLFPNAIKN IGLNCWTVSS RGKLASCPEG TAVLSCSCGS ACGSWDIREE KVCHCQCARI DWTAARCCKL QVAS.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT2 antibody, catalog no. 70R-3930</p>

<p>The Cocaine antibody is an effective tool in the field of Life Sciences. It is designed to target and bind to alpha-synuclein, a protein associated with low density lipoprotein receptor-related protein (LRP) and implicated in neurodegenerative disorders such as Parkinson's disease. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and western blotting. With its high specificity and affinity for alpha-synuclein, this antibody provides researchers with a valuable tool for studying the role of this protein in disease progression and developing potential therapeutic interventions. Whether you are working on basic research or drug development, the Cocaine antibody is an essential component for your experiments.</p>

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.</p>

<p>Rabbit polyclonal metC antibody (biotin)</p>

<p>LIN28 antibody was raised in Rabbit using Human LIN28 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of H2AFZ antibody, catalog no. 70R-10298</p>

<p>DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY</p>

<p>The LNK antibody is a highly versatile and potent growth factor that binds to specific proteins, promoting cellular growth and development. Through recombination technology, this antibody has been engineered to enhance its binding affinity and specificity, making it an ideal tool for various research applications in the field of Life Sciences.</p>

<p>DUSP19 antibody was raised in Rabbit using Human DUSP19 as the immunogen</p>

<p>ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC</p>

<p>Purified Recombinant TBE NS1 protein (His tag)</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>1-98 amino acids: MGSSHHHHHH SSGLVPRGSH MMCGAPSATQ PATAETQHIA DQVRSQLEEK ENKKFPVFKA VSFKSQVVAG TNYFIKVHVG DEDFVHLRVF QSLPHENKPL TLSNYQTNKA KHDELTYF</p>

<p>The Smad1 antibody is a highly specific monoclonal antibody that targets Smad1, a protein involved in cell signaling pathways. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>Purified recombinant Human STX12 Protein (His tag)</p>

<p>EphB2 antibody was raised in Mouse using a purified recombinant fragment of EphB2(aa17-200) expressed in E. coli as the immunogen.</p>

<p>Purified recombinant SERPING1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR40A antibody, catalog no. 70R-3213</p>

<p>D-dimer antibody is a monoclonal antibody used in the field of Life Sciences for various applications. It has been extensively studied and proven to be effective in detecting D-dimer, a fibrin degradation product that is elevated in blood plasma during thrombotic events. This antibody can be used in electrochemical biosensing techniques, such as electrochemical impedance spectroscopy and chemiluminescence immunoassay, to accurately measure D-dimer levels. The D-dimer antibody is immobilized on a carbon electrode or colloidal gold surface, allowing for specific binding with D-dimer molecules present in the sample. Its high selectivity and sensitivity make it an ideal tool for diagnosing and monitoring thrombotic disorders. Additionally, this antibody has shown promising antioxidant activity, making it a potential candidate for further research in the field of lipid composition and estradiol level regulation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Harbi1 antibody, catalog no. 70R-9342</p>

<p>Purified recombinant LIN7C protein</p>

<p>FBXL13 antibody was raised in Rabbit using Human FBXL13 as the immunogen</p>

<p>Rabbit polyclonal PYGB antibody (FITC)</p>

<p>PBD-BODIPY is an inhibitor that has been developed for use in cancer treatment. It is a potent and selective inhibitor of tumor cell growth, inducing apoptosis in cancer cells. PBD-BODIPY targets specific kinases that are involved in the growth and proliferation of cancer cells, inhibiting their activity and preventing further growth. This drug has also shown promising results when used in combination with other anticancer agents such as artesunate or linezolid. Studies have shown that PBD-BODIPY is effective against various types of human cancer cells including Chinese hamster ovary cells, and has been detected in urine after administration, indicating its potential for clinical use.</p>

<p>Valeriandoid F is an analog of a Chinese medicinal plant extract that has shown potential as an anti-cancer agent. It has been found to induce apoptosis in cancer cells, including those from human leukemia cell lines. Valeriandoid F is a potent inhibitor of kinase and protein activity, which are essential for the growth and proliferation of cancer cells. This compound has also been found to inhibit the growth of tumors in animal models. In addition, it has shown low toxicity levels and is excreted mainly through urine. Valeriandoid F is a promising candidate for the development of novel cancer therapies and inhibitors.</p>

<p>Desvenlafaxine fumarate is an inhibitor of tumor growth in human and Chinese cancer cells. It belongs to a group of inhibitors known as kinase inhibitors, which inhibit the activity of kinases involved in cell proliferation and survival. Desvenlafaxine fumarate has been shown to induce apoptosis (programmed cell death) in cancer cells, making it an effective anticancer agent. This drug is an analog of protein kinase inhibitors found in urine and has medicinal properties that make it useful for treating various types of cancer.</p>

<p>Hormaomycin is a potent inhibitor that has demonstrated the ability to induce apoptosis in cancer cells. It is an anticancer agent that has been isolated from urine samples of both Chinese and human medicinal sources. Hormaomycin works by inhibiting kinase activity, which can disrupt the cell cycle and prevent tumor growth. This inhibitor has shown promising results in both leukemia and other types of cancer cell lines, making it a potential candidate for future cancer treatments. Additionally, Hormaomycin is believed to be a protein inhibitor that may have broad applications in various fields of research.</p>

<p>Please enquire for more information about Phthalic acid-13C2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>J22352 is an inhibitor of cyclin-dependent kinases, a group of enzymes that play a crucial role in regulating cell division. It has shown strong anticancer activity against human cancer cells in vitro and in vivo. J22352 induces apoptosis, or programmed cell death, in cancer cells by inhibiting the activity of specific proteins involved in cell survival pathways. This compound is an analog of a natural product isolated from Chinese medicinal plants and has been shown to have potent kinase inhibitory activity. J22352 may be a promising candidate for the development of new anticancer drugs with improved efficacy and fewer side effects. Additionally, this compound can be detected in urine samples, making it a potential biomarker for cancer diagnosis and treatment monitoring.</p>

<p>Please enquire for more information about 3-Acenaphthenamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Nelfinavir-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>