Compuestos y reactivos bioquímicos

<p>Nestin antibody was raised in rabbit using residues 254-270 [RATEKFQLAVEALEQEK] of the 177 kDa human nestin protein as the immunogen.</p>

<p>Purified recombinant STAC protein (His tag)</p>

<p>Rabbit polyclonal MRPL21 antibody</p>

<p>IL10 antibody was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.</p>

<p>Rabbit Polyclonal IKK beta antibody</p>

<p>LOC642486 antibody was raised using the C terminal of LOC642486 corresponding to a region with amino acids AQASDLAENAPASPDVVISCHYCHRPPYTNSTRPAPPRLQPPLPGVQLQP</p>

<p>Mouse monoclonal COPS5 antibody</p>

<p>The SYNJ2 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets neuronspecific enolase and can be used to study adipose tissue and neuronal activity. This antibody has been shown to inhibit the activity of COX-2, an enzyme involved in inflammation, making it a potential therapeutic option for inflammatory conditions. Additionally, the SYNJ2 antibody has been used in particle reaction assays and transcription-polymerase chain reaction experiments to detect and measure the expression of specific proteins, such as β-catenin. Whether you're conducting research or developing a new medicament, this specific antibody can provide valuable insights into cellular processes and protein interactions.</p>

<p>IMPDH2 antibody was raised in Rabbit using Human IMPDH2 as the immunogen</p>

<p>Guinea pig polyclonal Hemoglobin antibody (FITC)</p>

<p>C2TA antibody was raised in rabbit using the C terminal of C2TA as the immunogen</p>

<p>The CD42d antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is specifically designed to target and neutralize syncytia formation, which is a process involved in the development of certain diseases. By inhibiting this process, the CD42d antibody can effectively prevent the formation of syncytia and reduce the severity of disease symptoms.</p>

<p>Purified Polyclonal CLIC4 antibody</p>

<p>Purified Polyclonal Claudin 19 antibody</p>

<p>DMTF1 antibody was raised in mouse using recombinant Cyclin D Binding Myb-Like Transcription Factor 1</p>

<p>Risperidone chemical reference substance</p>

<p>ZW10 antibody was raised in mouse using recombinant Human Zw10, Kinetochore Associated, Homolog (Drosophila) (Zw10)</p>

<p>Mouse monoclonal RNF113B antibody</p>

<p>The USP1 antibody is a high-quality monoclonal antibody that is widely used in Life Sciences research. It specifically binds to glycans and has been proven to be a potent inhibitor of gapdh, an enzyme involved in glycolysis. This antibody is an essential tool for studying the function and regulation of gapdh in various cellular processes. Additionally, the USP1 antibody has shown great potential as an antiviral agent due to its ability to target specific viral antigens. Its high affinity binding properties make it an ideal choice for researchers working with interleukins and other extracellular proteins. Furthermore, this antibody has also been found to play a crucial role in tumor-related macrophages, making it a valuable tool for cancer research. Whether you are conducting basic research or developing therapeutic strategies, the USP1 antibody is an indispensable resource for your scientific endeavors.</p>

<p>MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD</p>

<p>GPX5 antibody was raised in Rabbit using Human GPX5 as the immunogen</p>

<p>PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ</p>

<p>Rabbit polyclonal LAMC3 antibody</p>

<p>Mouse monoclonal AK5 antibody</p>

<p>KLK5 antibody was raised in Rabbit using Human KLK5 as the immunogen</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>The TP53 antibody is a highly effective monoclonal antibody that targets the TP53 protein, also known as tumor protein 53. This protein plays a crucial role in regulating cell division and preventing the formation of tumors. The TP53 antibody specifically binds to TP53 and activates its cytotoxic properties, leading to the destruction of cancer cells.</p>

<p>The Ret antibody is a highly specialized globulin that is used in the field of Life Sciences. It is an autoantibody that specifically targets the Ret protein complex, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to have neutralizing effects on the Ret protein, making it an important tool for research and development.</p>

<p>The CYP2J2 antibody is a highly specific monoclonal antibody that targets the glycoprotein CYP2J2. It is widely used in life sciences research and various immunoassays. This antibody has been shown to have cytotoxic effects, making it a valuable tool for studying the function of CYP2J2 in cellular processes. Additionally, it has neutralizing properties and can be used to inhibit the activity of CYP2J2 in experiments. The CYP2J2 antibody is also commonly used in studies involving irinotecan, fibrinogen, and actin, as it can facilitate the detection and quantification of these molecules. With its high specificity and versatility, this monoclonal antibody is an essential component for researchers in the field of molecular biology.</p>

<p>Mouse monoclonal PDE4A antibody</p>

<p>ZGPAT antibody was raised using the N terminal of ZGPAT corresponding to a region with amino acids DEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTE</p>

<p>Rabbit polyclonal PFN1 antibody (HRP)</p>

<p>CASP4 antibody was raised in Rabbit using Human CASP4 as the immunogen</p>

<p>Mouse monoclonal PVRL1 antibody</p>

<p>Mouse monoclonal NCAML1 antibody (N-terminus)</p>

<p>1-323 amino acids: MGSSHHHHHH SSGLVPRGSH MYHNSSQKRH WTFSSEEQLA RLRADANRKF RCKAVANGKV LPNDPVFLEP HEEMTLCKYY EKRLLEFCSV FKPAMPRSVV GTACMYFKRF YLNNSVMEYH PRIIMLTCAF LACKVDEFNV SSPQFVGNLR ESPLGQEKAL EQILEYELLL IQQLNFHLIV HNPYRPFEGF LIDLKTRYPI LENPEILRKT ADDFLNRIAL TDAYLLYTPS QIALTAILSS ASRAGITMES YLSESLMLKE NRTCLSQLLD IMKSMRNLVK KYEPPRSEEV AVLKQKLERC HSAELALNVI TKKRKGYEDD DYVSKKSKHE EEEWTDDDLV ESL</p>

<p>The HSV1 protein is a native protein that plays a crucial role in various biological processes. It acts as an epidermal growth factor, promoting cell growth and differentiation. This protein exhibits excellent photostability, making it ideal for use in life sciences research. It can be used as a monoclonal antibody or in combination with other native proteins and antigens.</p>

<p>The BAX antibody is a highly specialized monoclonal antibody that targets the BAX protein, which plays a crucial role in programmed cell death (apoptosis). This steroid and multidrug-resistant protein is involved in regulating the release of cytochrome c from mitochondria, ultimately leading to apoptosis. The BAX antibody specifically binds to the BAX protein, preventing its function and promoting cell survival.</p>

<p>NR2C2 antibody was raised using the N terminal of NR2C2 corresponding to a region with amino acids INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK</p>

<p>Mioflazine is a ligand that binds to the ion channels and induces a conformational change in the protein. It has been used as a pharmacological tool in the study of ion channels, a research tool in cell biology, and as an inhibitor of peptide-mediated reactions. Mioflazine is a high-purity product that is supplied at &gt; 99% purity.</p>

<p>4-(2-(1H-Imidazol-1-yl)ethoxy)benzoic acid hydrochloride is a synthetic chemical compound, which is typically sourced through organic synthesis methods. This compound is characterized by its unique structure featuring an imidazole group linked to a benzoic acid moiety via an ethoxy bridge. The mode of action of this compound predominantly involves interactions at a molecular level with various biological targets, potentially influencing biochemical pathways by mimicking or inhibiting natural biological molecules.</p>

<p>Inhibitor of cyclin-dependent kinases CDK1 and CDK2</p>

<p>Inhibits deubiquitinase</p>

<p>Glutamate is an amino acid that is the major excitatory neurotransmitter in the central nervous system. It is found in many foods and dietary supplements. Glutamic acid may be converted to glutamine by the enzyme glutaminase, and then converted to glutamate again by the enzyme glutaminase. Glutamate is a metabolic intermediate in various biochemical reactions, including synthesis of proteins, lipids, and nucleic acids. Glutamic acid is also used as a food additive and has antimicrobial properties.</p>

<p>Ciwujianoside A1 is a saponin compound, which is isolated from the roots of the Eleutherococcus senticosus plant, commonly known as Siberian ginseng. This compound belongs to the family of triterpenoid saponins, which are notable for their diverse biological activities. Ciwujianoside A1 primarily acts by interacting with specific cellular pathways, including modulating immune responses and exerting antioxidative effects.</p>

<p>Methyltetrazine agarose is a 6% crosslinked agarose resin that is activated with methyltetrazine functional groups for covalent immobilization of TCO-modified biomolecules via a Diels–Alder  reaction. Applications are preparation of protein agarose media with almost quantitative capture of proteins.<br>Activation level: 10-20 µmol methyltetrazine groups per mL resin<br>Bead size: 50-150 µm</p>

<p>Please enquire for more information about Renin inhibitor peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TAT-Gap19 is a peptide that has been shown to reduce inflammation and microbial infection in animal models. TAT-Gap19 is an extracellular soluble protein that can enter the cell by endocytosis and activate microglial cells. It also has the ability to inhibit the uptake of fatty acids, which are important for inflammatory responses. TAT-Gap19 can be used as a therapeutic agent for chronic liver injury, osmotic pump, or hypothalamic neurons. TAT-Gap19 also has been shown to inhibit dopamine release from dopaminergic neurons in mice with Parkinson's disease.</p>

<p>Pd-85639 is a synthetic small molecule, which is a product of laboratory-derived chemical synthesis. Its structure mimics certain naturally occurring biomolecules that interact with cellular pathways pivotal in the regulation of cell growth and apoptosis. Specifically, Pd-85639 operates by inhibiting specific enzymes and signaling pathways, leading to the disruption of malignant cell proliferation and induction of programmed cell death.</p>

<p>CBA is a reactive intermediate that is formed by the conjugation of two molecules. It has been shown to be cytotoxic and to have anti-viral effects in vitro. CBA has also been shown to be an effective treatment for lymphocytic leukemia in mice. It was found that CBA was able to inhibit the proliferation of virus-infected cells and to reduce the production of virus progeny. Moreover, it has been shown that CBA can bind to cation channels and linear model systems, thus inhibiting the flow of ions across cell membranes. The most likely mechanism for CBA's antiviral activity is its ability to interfere with viral DNA replication or RNA synthesis, which may be due to its ability to react with nucleic acids.</p>

<p>(S)-Hydroxychloroquine sulfate is a research tool that is used as an activator for the production of antibodies and to study the interactions between peptides and proteins. (S)-Hydroxychloroquine sulfate has been shown to inhibit ion channels, such as voltage-gated sodium channels. It also inhibits protein interactions, such as receptor-ligand interactions.</p>

<p>Gamitrinib is a small molecule that inhibits polymerase chain reaction (PCR) and transcription-quantitative polymerase chain reaction (RT-qPCR). Gamitrinib binds to the polymerase enzyme, blocking DNA replication. It also has anti-tumor effects, inhibiting the growth of skin cancer cells. Gamitrinib blocks mitochondrial functions by binding to the mitochondrial DNA. This drug also has synergistic effects with other cancer drugs, such as temozolomide. Gamitrinib is a competitive inhibitor of ryanodine receptor and blocks mitochondrial membrane potential, leading to cell death.</p>

<p>Please enquire for more information about Triazadodecanoic acid methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polyvinyl sulfate potassium (PVS) is a polymer that is soluble in water and organic solvents. It has been shown to be an effective inhibitor of the ryanodine receptor, which is responsible for calcium release from the sarcoplasmic reticulum of skeletal and cardiac muscle cells. PVS has also been found to decrease viral life by binding to the surface glycoprotein of HIV-1. This polymer can be used as a cholesterol-lowering agent by binding with cholesterol at high concentrations and preventing its absorption into the bloodstream. PVS has also been shown to have a high resistance to chemical degradation, making it an excellent candidate for use in biomedical devices such as catheters, vascular grafts, and implants.</p>

<p>OATD-01 is a small molecule that has been shown to activate the Ligand-Gated Ion Channel (LGIC) receptor. This receptor regulates the flow of ions and regulates cell membrane potential, which is important in maintaining cell homeostasis. OATD-01 has been shown to be a potent activator of LGIC receptors, inducing ion flux and membrane depolarization.</p>

<p>JNK inhibitor XVI is an inhibitor drug that inhibits the JNK protein kinase, which is a member of the MAPK family. It has been shown to inhibit the growth of breast cancer cells in vitro. JNK inhibitor XVI also inhibits autophagy and reactive oxygen species production in these cells, leading to cell death. This drug may be a potential treatment for colorectal adenocarcinoma and epidermal growth factor receptor (EGFR) -positive cancer.</p>

<p>Please enquire for more information about 2-Phenyl-4-nitrosophenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BMS 345541 is a selective inhibitor of IKK-β, which is an enzyme involved in the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathway. It is synthesized through chemical synthesis, which allows for its precise targeting and modulation of specific signaling cascades.</p>

<p>ICG-001 is a small molecule inhibitor that specifically targets the Wnt/β-catenin signaling pathway. This compound is derived from a rational drug design approach aimed at disrupting the interaction between β-catenin and its coactivator cyclic AMP response element-binding protein (CBP). By selectively inhibiting this interaction, ICG-001 effectively downregulates the transcriptional activity mediated by β-catenin without affecting its structural role in cell adhesion.</p>

<p>Please enquire for more information about O,o-Dimethyl malathion including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SD 2590 is a research tool used in Cell Biology, Pharmacology, and Ion channels. SD 2590 is an inhibitor that reacts with peptides, receptors, and ion channels. It also has the ability to activate ligand-gated ion channels. SD 2590 is a high-purity product that is available in quantities of 100mg or 1g.</p>

<p>Vonoprazan fumarate is a pharmaceutical compound that functions as a potassium-competitive acid blocker (PCAB), which is derived from synthetic sources. It acts by selectively inhibiting the gastric hydrogen-potassium ATPase enzyme, commonly known as the proton pump, located in the stomach lining. This mode of action results in a significant reduction in gastric acid secretion, offering a therapeutic alternative to traditional proton pump inhibitors (PPIs).</p>

<p>BCH001 is a cell-based therapy that is indicated for use in neonates with congenital heart disease. It can be used to treat pulmonary fibrosis. BCH001 is an autologous bone marrow mononuclear cell product that contains telomerase, which has the ability to stabilize and maintain telomere length. The cells are injected into the patient’s blood stream and travel through the body. BCH001 cells have been shown to be able to differentiate into various types of cells such as cardiomyocytes and endothelial cells, depending on its environment. BCH001 also has the ability to stimulate production of pluripotent stem cells by activating genes that control pluripotency markers, making it a potential treatment for congenital diseases in children.</p>

<p>CH5183284 is a monoclonal antibody that binds to the tyrosine kinase domain of the HER2 protein. It has been shown to inhibit angiogenesis in vitro, which may be due to its ability to block epidermal growth factor (EGF) signalling. This drug also inhibits EGF-induced migration of prostate cancer cells and skin cancer cells in vitro. CH5183284 has potential as a biomarker for tumours that overexpress HER2, as well as being a potential target for cancer therapy.</p>

<p>Lifirafenib is a potent and selective kinase inhibitor, which is synthetically derived. It operates by targeting and inhibiting specific pathways involving the RAF kinases within the MAPK/ERK signaling cascade. This interruption is critical in the control of cellular proliferation and survival, pathways often dysregulated in various cancers. Lifirafenib is particularly effective against BRAF-mutant cancers, including melanoma and certain types of thyroid and colorectal cancers.</p>

<p>MKC 9989 is a small molecule that is designed to target cancer cells. It has been shown to cause cell dysfunction by binding to lysine residues on the surface of cancer cells and removing proton from the cell, which impairs its ability to function. MKC 9989 also binds to hydrogen bonds on the surface of cancer cells and prevents them from forming imines, which are important for cellular metabolism. This drug has been shown to be effective in treating cancers in animal models and may be used as an alternative treatment option for patients who have not responded well to other therapies such as chemotherapy or radiation therapy.</p>

<p>CW 008 is a pharmaceutical compound that has shown to be an inhibitor of cancer stem cells and their ability to induce apoptosis. It also prevents autophagy, which is a process of self-eating that cancer cells use to survive. CW 008 has been shown to inhibit activin, which are proteins that are known for their teratogenic effects on the ovary and other tissues. CW 008's effect on meiotic cells is not yet clear, but it does not seem to have any effect on culturing human embryonic stem cells.<br>CW 008 was first discovered in the 1990s when it was found to be a potent inhibitor of leukemia cells in mice. This discovery led to further investigation into its properties as an anticancer agent and its potential applications in chemotherapy.</p>

<p>Inhibitor of checkpoint kinase CHK1</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Myt1 is a human ion channel protein that belongs to the superfamily of ligand-gated ion channels. The protein is localized in the postsynaptic membrane and is activated by glutamate. Myt1 plays an important role in synaptic plasticity and memory formation, which are essential for learning and memory. Myt1 has also been shown to be involved in the regulation of neuronal excitability because it mediates calcium influx into neurons and regulates potassium efflux from neurons. Myt1 has been used as a research tool to investigate protein interactions, such as those with receptor proteins such as GluR2 or L-type calcium channels.<br>Myt1 can also be used as an antibody to study its function on other proteins, such as AMPA receptors, or to identify other proteins that interact with myt1.</p>

<p>The 1-morpholino-1-(thiophen-2-yl)propane-2-yl)-3-(2-(trifluoromethoxy)phenyl)thiourea (MTT) is a research tool, which is used as an activator, ligand, receptor or cell biology. It has been shown to inhibit ion channels and cause changes in the properties of protein interactions. The MTT has also been shown to be an inhibitor of peptides.</p>

<p>16:0-18:0-16:0 d5 Tg is a synthetic tracer peptide that inhibits the activity of ligand binding to receptor. It can be used in pharmacology, protein interactions, and cell biology research. 16:0-18:0-16:0 d5 Tg has an amino acid sequence of Ac-KLHILPYKLNQVSVTRKGSTLTVSS and is made up of 16% leucine, 18% valine, and 16% threonine. This tracer peptide has a molecular weight of 607 Daltons and a purity level of &gt; 98%. It is soluble in water and has a shelf life of one year.</p>

<p>Edaglitazone is a drug used for the treatment of type 2 diabetes. It belongs to the class of thiazolidinedione drugs, which are insulin sensitizers. Edaglitazone has shown anti-inflammatory properties and may be useful in treating inflammatory diseases such as rheumatoid arthritis. This drug can also be used as a diagnostic tool to measure insulin sensitivity in humans by measuring erythrocyte glucose uptake. Edaglitazone has been shown to inhibit tumor growth and induce apoptosis in cancer cells, but not healthy cells, in animal models.</p>

<p>PARP Inhibitor XIV is a small molecule that inhibits the enzyme poly (ADP-ribose) polymerase (PARP). PARP is involved in DNA repair and cell proliferation, so inhibiting its activity can lead to apoptosis. PARP inhibitor XIV has been shown to cause tumor regression in animal models and has been shown to be effective against hyperproliferative diseases such as cancer. It has also been shown to increase pluripotent cells, which are cells that can differentiate into any type of cell. The effective dose of PARP inhibitor XIV is unknown, but it increases cytotoxicity when used with fatty acids.</p>

<p>M 1145 is a monoclonal antibody, which is derived from a highly specific and engineered immunoglobulin source. Its mode of action involves targeting and modulating specific immune cell receptors, disrupting signaling pathways that are critical for the activation and proliferation of these cells. As a result, it can effectively modulate immune responses, making it a promising candidate for therapeutic applications in autoimmune diseases and certain types of cancers.</p>

<p>Rabbit polyclonal ELOA2 antibody</p>

<p>PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM</p>

<p>Rat monoclonal CD244.2 antibody (FITC)</p>

<p>Purified recombinant EXOSC3 protein (His tag)</p>

<p>Az7550 hydrochloride is a research tool for the study of ion channels and receptor interactions. It is a ligand that binds to the peptide receptor site on the cell membrane and activates the channel, leading to an influx of ions into the cell. Az7550 hydrochloride has been shown to activate potassium channels by binding to their ligand-binding site.<br>Az7550 hydrochloride has also been used as an antibody labeling agent for immunofluorescence staining.</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr493)</p>

<p>PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL</p>

<p>IRS1 antibody was raised in Rabbit using Human IRS1 as the immunogen</p>

<p>KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG</p>

<p>Rabbit polyclonal TCEAL3 antibody</p>

<p>The Albumin antibody is a powerful tool for researchers working with human albumin. This monoclonal antibody specifically targets and binds to albumin, allowing for precise detection and analysis. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>Purified Polyclonal GRLF1 antibody</p>

<p>Rabbit polyclonal NFKB1 antibody (biotin)</p>

<p>Rabbit polyclonal TAC1 antibody</p>

<p>Purified Polyclonal cJun antibody</p>

<p>AZD9977 is a peptide that has been shown to inhibit the activity of a number of proteins, including protein interactions, activator and ligand. It is also an inhibitor for CAS No. 1850385-64-6 and has been shown to be a research tool for studying the function of ion channels and receptors. The antibody has been used to study the localization of ion channels in rat hippocampal neurons. AZD9977 is also an inhibitor for CAS No. 1850385-64-6 with high purity and is a useful reagent for life sciences as well as high quality research tools.</p>

<p>Rabbit polyclonal CSFR antibody (Tyr809)</p>

<p>Mouse monoclonal HSPA6 antibody</p>

<p>Purified Polyclonal TNFAIP1 antibody</p>

<p>ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK</p>

<p>Mouse monoclonal HLADQ antibody</p>

<p>1-339 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMST VHEILCKLSL EGDHSTPPSA YGSVKAYTNF DAERDALNIE TAIKTKGVDE VTIVNILTNR SNAQRQDIAF AYQRRTKKEL ASALKSALSG HLETVILGLL KTPAQYDASE LKASMKGLGT DEDSLIEIIC SRTNQELQEI NRVYKEMYKT DLEKDIISDT SGDFRKLMVA LAKGRRAEDG SVIDYELIDQ DARDLYDAGV KRKGTDVPKW ISIMTERSVP HLQKVFDRYK SYSPYDMLES IRKEVKGDLE NAFLNLVQCI QNKPLYFADR LYDSMKGKGT RDKVLIRIMV SRSEVDMLKI RSEFKRKYGK SLYYYIQQDT KGDYQKALLY LCGGDD</p>

<p>Purified recombinant PHGDH protein (His tag)</p>