Compuestos y reactivos bioquímicos

<p>Rabbit polyclonal GK3P antibody</p>

<p>HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET</p>

<p>Rabbit Polyclonal DUSP16 antibody</p>

<p>LRRC4C antibody was raised in Rabbit using Human LRRC4C as the immunogen</p>

<p>The MCL1 antibody is a monoclonal antibody used in Life Sciences. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α), which is involved in inflammation and cell death. This antibody can also target molecules such as insulin and growth factors, making it a valuable tool in research and therapeutic applications. Additionally, the MCL1 antibody can be used to detect specific proteins, including rubisco, and can be utilized in various immunoassays. With its specificity and versatility, this monoclonal antibody is a valuable asset for scientists and researchers in the field of Life Sciences.</p>

<p>Purified Rabbit polyclonal NFKBID antibody</p>

<p>Pig Plasma is a high-quality biospecimen that is commonly used in various research and veterinary applications. It contains a wide range of important components, including chemokines, antibodies, interferons, and glycoproteins. Pig Plasma also contains neutralizing agents that can inhibit the activity of harmful pathogens. This product is particularly useful for studying the antiviral properties of certain substances or developing new therapeutic interventions. Additionally, Pig Plasma can be utilized in liver microsome studies to assess drug metabolism and evaluate potential drug-drug interactions. With its diverse array of components and versatile applications, Pig Plasma is an essential resource for researchers and veterinarians alike.</p>

<p>Mouse monoclonal PRKAR1B antibody</p>

<p>Purified Rabbit polyclonal p53 antibody (Ser20)</p>

<p>MARCKS antibody is a neutralizing peptide agent that targets interleukin-6 (IL-6), an important cytokine involved in immune responses. It acts as an anticoagulant by inhibiting the activation of coagulation factors. The monoclonal antibody specifically binds to MARCKS, a protein involved in cell signaling and cytoskeletal regulation. By blocking the interaction between MARCKS and its binding proteins, the antibody disrupts cellular processes such as cell adhesion, migration, and proliferation. Additionally, it has been shown to inhibit the binding of fibrinogen and colony-stimulating factor (M-CSF) to their respective receptors, further modulating cellular responses. This antibody is glycosylated, meaning it has attached glycans or glycopeptides that can affect its stability and activity. Its activated form has been extensively studied for its potential therapeutic applications in autoimmune diseases and cancer.</p>

<p>LDHC antibody was raised in Rabbit using Human LDHC as the immunogen</p>

<p>Recombinant Human THOC7 protein (His tag)</p>

<p>Rabbit polyclonal RXRC antibody</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME</p>

<p>FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)</p>

<p>Rat monoclonal TRANCE antibody (biotin)</p>

<p>Rabbit polyclonal BTBD2 antibody (FITC)</p>

<p>Rabbit polyclonal Troponin I antibody (Ser43)</p>

<p>Purified Rabbit polyclonal IGF2R antibody (Ser2409)</p>

<p>Rat monoclonal Ly6A/E antibody (biotin)</p>

<p>Rabbit polyclonal VPS24 antibody</p>

<p>EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS</p>

<p>ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA</p>

<p>The CDCP1 antibody is a monoclonal antibody that specifically targets the surface glycoprotein known as CDCP1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various phenotypic assays. The CDCP1 antibody has demonstrated its ability to inhibit epidermal growth factor-induced cell proliferation and migration, making it a potential therapeutic agent for diseases related to abnormal cell growth. Additionally, this antibody has been used as a diagnostic agent for the detection of CDCP1 expression in cancer cells. Its high specificity and affinity make it an ideal tool for identifying and studying CDCP1-expressing cells. The use of monoclonal antibodies like the CDCP1 antibody has revolutionized the field of molecular targeting and continues to contribute to advancements in research and medicine.</p>

<p>The PLD4 antibody is a valuable tool in the field of Life Sciences. It plays a crucial role in various biological processes, including calpain activation, fibronectin matrix assembly, and endothelial cell growth. This medicament is an adeno-associated virus (AAV) vector-based Polyclonal Antibody that specifically targets PLD4. The antibody binds to PLD4 and inhibits its activity, leading to a decrease in collagen production and angiogenesis.</p>

<p>The Hexokinase 1 antibody is a powerful tool used in Life Sciences research. It is an antibody specifically designed to target and bind to Hexokinase 1, an enzyme involved in glucose metabolism. This antibody has been shown to be highly effective in various applications, including the study of fatty acid metabolism, insulin-like growth factor signaling, and the role of Hexokinase 1 in diseases such as cancer.</p>

<p>AVIL antibody was raised in Rabbit using Human AVIL as the immunogen</p>

<p>Mouse Monoclonal FUBP1 antibody</p>

<p>LAPTM4A antibody was raised using the middle region of LAPTM4A corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA</p>

<p>Purified recombinant RAET1E protein</p>

<p>NEI3 antibody was raised in rabbit using residues 164-177 (LRAESEVKKQKGRMLG) of the human NEI3 protein as the immunogen.</p>

<p>AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK</p>

<p>Rabbit polyclonal ZNF366 antibody</p>

<p>Purified recombinant CNPY4 protein (His tag)</p>

<p>Rabbit polyclonal RPN1 antibody</p>

<p>The PM20D1 antibody is a specific antibody that targets the PM20D1 antigen. It is commonly used in Life Sciences research to study the role of PM20D1 in various biological processes. This antibody is particularly useful as a serum marker for detecting the presence of PM20D1 in biological samples. It can be used in techniques such as immunohistochemistry and Western blotting to visualize and quantify the expression of PM20D1. Additionally, this antibody can be used as a tool to investigate the potential therapeutic applications of PM20D1 inhibitors or as a diagnostic tool for detecting autoantibodies against PM20D1. Its high specificity and sensitivity make it an essential component in many research studies related to dopamine metabolism, zinc chelation, fetal hemoglobin regulation, and other areas of interest in the field of Life Sciences.</p>

<p>BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL</p>

<p>GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG</p>

<p>The Beta-2-microglobulin monoclonal antibody is a highly specialized antibody that targets and interacts with beta-2-microglobulin, a protein found on the surface of various cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.</p>

<p>IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL</p>

<p>Mouse monoclonal MPP5 antibody</p>

<p>The MDM2 antibody is a neutralizing monoclonal antibody that targets the MDM2 protein. It has been shown to inhibit the activity of interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), two pro-inflammatory cytokines involved in immune responses. This antibody is reactive against adipose tissue and has been used in studies involving conditions such as obesity and metabolic disorders. Additionally, the MDM2 antibody has shown potential therapeutic effects against Brucella abortus, a bacterial pathogen that causes brucellosis. The colloidal gold-labeled MDM2 antibody can be used for immunohistochemistry or immunocytochemistry applications. This antibody also demonstrates inhibitory activity against certain family kinases and amyloid proteins. Overall, the MDM2 antibody offers a versatile tool for researchers studying various biological processes and diseases related to MDM2 and its associated pathways.</p>

<p>delta Catenin antibody was raised in mouse using synthetic peptide J6 (corresponding to aa 292-309) coupled to KLH as the immunogen.</p>

<p>Human IgG1 antibody was raised in mouse using IgG1 Fc region as the immunogen.</p>

<p>GPR61 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SLP76 antibody</p>

<p>Sheep polyclonal Progesterone 4 antibody</p>

<p>TNF alpha antibody was raised in goat using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>The MAFK antibody is a highly effective substance used in Life Sciences research. It is a recombinant antigen that specifically targets the polypeptide expression of MAFK, which plays a crucial role in various cellular processes. This antibody has been extensively studied and found to inhibit the activity of arginase, an enzyme involved in the metabolism of arginine. Additionally, it has shown potential as a therapeutic agent for non-alcoholic steatohepatitis (NASH) due to its ability to modulate the function of microvessel endothelial cells.</p>

<p>Purified recombinant USP15 protein (His tag)</p>

<p>Introducing the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside: The Ultimate Antituberculosis Solution</p>

<p>Purified recombinant SGCD protein (His tag)</p>

<p>Rat monoclonal Toll-like receptor 9 antibody</p>

<p>Purified Rabbit polyclonal MRPS30 antibody</p>

<p>Purified Polyclonal GPR153 antibody</p>

<p>Mouse monoclonal C21orf59 antibody</p>

<p>The MYD88 antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to MYD88, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its efficacy and specificity.</p>

<p>TMB Substrate is a highly versatile and effective monoclonal antibody used in Life Sciences research. It is commonly used for the detection of growth factors and neutralizing inhibitors, particularly in studies related to oncostatin. This substrate offers exceptional sensitivity and produces a strong signal, making it ideal for various applications such as ELISA assays.</p>

<p>The DARPP32 antibody is a powerful tool in the field of Life Sciences and medicine. It is an inhibitor that targets the bromodomain, which plays a crucial role in proteolytic processes. This antibody has been shown to effectively inhibit tumor cell growth and metastasis by blocking the activity of metalloproteinases.</p>

<p>PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI</p>

<p>Rabbit polyclonal VAMP3 antibody</p>

<p>CAV1 antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) S G G K Y V D S E G H L Y T V P(17) C of human CAV1 as the immunogen.</p>

<p>Rabbit polyclonal RAB6A antibody</p>

<p>Rabbit polyclonal SHC4 antibody</p>

<p>Rabbit polyclonal CKMT antibody (FITC)</p>

<p>Purified Polyclonal Alpha adducin antibody</p>

<p>The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.</p>

<p>IL17 antibody was raised in goat using highly pure recombinant hIL-17A as the immunogen.</p>

<p>OVA conjugated Glutathione Hapten</p>

<p>CCND1 antibody was raised in rabbit using the N terminal of CCND1 as the immunogen</p>

<p>The cMet antibody is a highly effective inhibitor that targets low-density receptors in the Life Sciences field. It has been shown to significantly reduce cortisol concentration and inhibit the activity of androgen, thereby providing relief from various hormonal imbalances. This medicament is specifically designed to target antibodies, including trastuzumab and polyclonal antibodies, which are known to play a crucial role in autoimmune disorders. The cMet antibody works by blocking the activation of tyrosine kinases, which are responsible for initiating abnormal cell growth and proliferation. With its exceptional performance in laboratory assays, this antibody has proven to be a valuable tool for researchers and clinicians alike in the pursuit of understanding and combating autoimmune diseases.</p>

<p>The USP33 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that has been developed specifically for use in human hepatocytes. This antibody is used as a medicament to target specific proteins and molecules within the cells, such as collagen, lectins, cytotoxic elastase, and growth factors like TGF-beta. The USP33 antibody has been extensively tested and validated for its efficacy in detecting and quantifying these targets in various biological samples, including human serum and pancreatic elastase. Its high specificity and sensitivity make it an essential tool for researchers and scientists working in the field of molecular biology and biochemistry.</p>

<p>ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW</p>

<p>UMODL1 antibody was raised in rabbit using the middle region of UMODL1 as the immunogen</p>

<p>FT-1518 is a potent anticancer inhibitor that targets protein kinases involved in cell cycle regulation and apoptosis. It is an analog of Chinese medicinal compounds that have been used for centuries to treat cancer. FT-1518 has been shown to selectively inhibit the growth of tumor cells, both in vitro and in vivo, while sparing normal cells. This compound has demonstrated significant activity against a range of human cancers, including breast, lung, colon, prostate, and ovarian cancer. FT-1518 inhibits the activity of specific kinases involved in cancer cell proliferation and survival. It has also been found to induce apoptosis in cancer cells by activating caspase-mediated pathways. Moreover, FT-1518 is excreted primarily through urine and has minimal toxicity towards normal cells. Overall, FT-1518 represents a promising new class of kinase inhibitors with potential therapeutic applications for the treatment of various types of cancer.</p>

<p>The USP33 antibody is a polyclonal antibody that is commonly used in life sciences research. It specifically targets the USP33 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in detecting and quantifying USP33 levels in different samples.</p>

<p>Nexinhib 20 is a pro-inflammatory cytokine inhibitor that inhibits the production of pro-inflammatory cytokines, such as IL-1β and TNFα. It has been shown to be effective in reducing the growth of primary tumor cells and also reduces inflammation in diseases such as cancer, inflammatory bowel disease (IBD), and bowel diseases. Nexinhib 20 is not absorbed well when ingested orally due to its low bioavailability. It is also an acidic protein with a pI of 4.8.</p>

<p>TLE1 antibody was raised in rabbit using the N terminal of TLE1 as the immunogen</p>

<p>Zidovudine (USP grade powder) chemical reference substance</p>

<p>PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ</p>

<p>The MCL1 antibody is a highly specialized monoclonal antibody that targets the phosphatase growth factor. It has been specifically designed to neutralize tyrosine and colloidal substances in the body, making it an effective tool for various medical applications. This antibody has shown promising results in inhibiting the activity of glial fibrillary acidic proteins, which are associated with neurodegenerative diseases. Additionally, it has demonstrated its efficacy in targeting and neutralizing the circumsporozoite protein, making it a potential candidate for the development of vaccines against certain infectious diseases. The MCL1 antibody is a valuable asset in the field of medical research and holds great promise for future therapeutic interventions.</p>

<p>Sox2 antibody was raised in rabbit using residues 113-127 [KEHPDYKYRPRRKTK] of the 37 kDa human Sox2 protein as the immunogen.</p>

<p>Rat monoclonal CD24 antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its efficacy through various techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL</p>

<p>The FGF1 antibody is a monoclonal antibody that specifically targets the HER2 protein. It belongs to the class of anti-HER2 antibodies, which also includes adalimumab and trastuzumab. This antibody binds to HER2, preventing its interaction with other biomolecules and inhibiting downstream signaling pathways involved in cell growth and division.</p>

<p>The Vimentin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and detect vimentin, an intermediate filament protein that plays a crucial role in maintaining cell structure and integrity. This antibody is particularly useful in research related to amyloid plaque formation, as it can identify activated vimentin in these structures.</p>

<p>The ALDH1L1 antibody is a highly reactive collagen-specific antibody that is commonly used in the field of Life Sciences. This monoclonal antibody has been specifically designed to target and bind to the activated form of collagen, which is a key component of various biological processes. It can be used for applications such as immobilization and detection of collagen in samples, as well as for studying the role of collagen in different cellular pathways.</p>

<p>Mouse monoclonal MICAL1 antibody</p>

<p>Purified recombinant WNT7A protein (His tag)</p>

<p>MPP7 antibody was raised in Rabbit using Human MPP7 as the immunogen</p>

<p>Mouse monoclonal SERPINA5 antibody</p>

<p>Rabbit polyclonal TINAGL1 antibody</p>

<p>Rabbit polyclonal SFRS17A antibody</p>

<p>The XRCC5 antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. This antibody is specifically designed to target XRCC5, which is an important protein involved in DNA repair and recombination. The XRCC5 antibody can be used for immobilization on electrodes, making it useful in techniques such as electrochemical immunoassays. Additionally, this antibody has been shown to be effective in detecting hormone peptides, including anti-HBs and c-myc, in human serum samples. It can also be used to study the serotonergic system and investigate the role of XRCC5 in fatty acid metabolism. With its broad range of applications, the XRCC5 antibody is a valuable tool for researchers working in various fields of study within Life Sciences.</p>

<p>AKT2 antibody was raised in rabbit using the middle region of AKT2 as the immunogen</p>

<p>CAMK1D antibody was raised in Rabbit using Human CAMK1D as the immunogen</p>

<p>Penicillin antibody was raised in mouse using penicillin as the immunogen.</p>

<p>Sheep polyclonal Nicarbazin antibody</p>